BLASTX nr result
ID: Jatropha_contig00018502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018502 (133 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN05747.1| hypothetical protein AMTR_s00006p00249860 [Ambore... 83 3e-14 gb|EOY03029.1| Eukaryotic release factor 1-3 [Theobroma cacao] 83 3e-14 ref|XP_004493119.1| PREDICTED: eukaryotic peptide chain release ... 83 3e-14 ref|XP_004161683.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic p... 83 3e-14 ref|XP_004142086.1| PREDICTED: eukaryotic peptide chain release ... 83 3e-14 ref|XP_004140563.1| PREDICTED: eukaryotic peptide chain release ... 83 3e-14 gb|ADN33689.1| eukaryotic peptide chain release factor subunit [... 83 3e-14 emb|CBI19672.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002321067.1| predicted protein [Populus trichocarpa] gi|2... 83 3e-14 gb|ABK93188.1| unknown [Populus trichocarpa] 83 3e-14 ref|XP_002283027.1| PREDICTED: eukaryotic peptide chain release ... 83 3e-14 ref|XP_002271457.1| PREDICTED: eukaryotic peptide chain release ... 82 5e-14 ref|XP_006367237.1| PREDICTED: eukaryotic peptide chain release ... 82 7e-14 ref|XP_006345874.1| PREDICTED: eukaryotic peptide chain release ... 82 7e-14 gb|ESW33777.1| hypothetical protein PHAVU_001G097700g [Phaseolus... 82 7e-14 gb|ESW23679.1| hypothetical protein PHAVU_004G067400g [Phaseolus... 82 7e-14 gb|ESR60089.1| hypothetical protein CICLE_v10015281mg [Citrus cl... 82 7e-14 gb|EMJ16602.1| hypothetical protein PRUPE_ppa005931mg [Prunus pe... 82 7e-14 ref|XP_004249948.1| PREDICTED: eukaryotic peptide chain release ... 82 7e-14 ref|XP_004239730.1| PREDICTED: eukaryotic peptide chain release ... 82 7e-14 >gb|ERN05747.1| hypothetical protein AMTR_s00006p00249860 [Amborella trichopoda] Length = 437 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|EOY03029.1| Eukaryotic release factor 1-3 [Theobroma cacao] Length = 437 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_004493119.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Cicer arietinum] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 207 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 250 >ref|XP_004161683.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic peptide chain release factor subunit 1-3-like [Cucumis sativus] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_004142086.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Cucumis sativus] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_004140563.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Cucumis sativus] gi|449487371|ref|XP_004157593.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Cucumis sativus] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|ADN33689.1| eukaryotic peptide chain release factor subunit [Cucumis melo subsp. melo] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >emb|CBI19672.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 239 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 282 >ref|XP_002321067.1| predicted protein [Populus trichocarpa] gi|222861840|gb|EEE99382.1| hypothetical protein POPTR_0014s13720g [Populus trichocarpa] Length = 436 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|ABK93188.1| unknown [Populus trichocarpa] Length = 287 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 59 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 102 >ref|XP_002283027.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 [Vitis vinifera] gi|147780810|emb|CAN77215.1| hypothetical protein VITISV_036372 [Vitis vinifera] Length = 437 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_002271457.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 [Vitis vinifera] Length = 437 Score = 82.4 bits (202), Expect = 5e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNVA LILAGSADFKTELS SDMFDPRLQAK+ Sbjct: 208 ATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDPRLQAKL 251 >ref|XP_006367237.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform X1 [Solanum tuberosum] gi|565403587|ref|XP_006367238.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform X2 [Solanum tuberosum] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_006345874.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 isoform X1 [Solanum tuberosum] gi|565358116|ref|XP_006345875.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 isoform X2 [Solanum tuberosum] gi|565358118|ref|XP_006345876.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3 isoform X3 [Solanum tuberosum] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|ESW33777.1| hypothetical protein PHAVU_001G097700g [Phaseolus vulgaris] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|ESW23679.1| hypothetical protein PHAVU_004G067400g [Phaseolus vulgaris] Length = 436 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|ESR60089.1| hypothetical protein CICLE_v10015281mg [Citrus clementina] gi|557549461|gb|ESR60090.1| hypothetical protein CICLE_v10015281mg [Citrus clementina] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >gb|EMJ16602.1| hypothetical protein PRUPE_ppa005931mg [Prunus persica] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_004249948.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like [Solanum lycopersicum] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251 >ref|XP_004239730.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform 1 [Solanum lycopersicum] gi|460388148|ref|XP_004239731.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform 2 [Solanum lycopersicum] gi|460388150|ref|XP_004239732.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform 3 [Solanum lycopersicum] gi|460388152|ref|XP_004239733.1| PREDICTED: eukaryotic peptide chain release factor subunit 1-3-like isoform 4 [Solanum lycopersicum] Length = 437 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 ATQFFINPATSQPNVARLILAGSADFKTELSLSDMFDPRLQAKI 132 ATQFFINPATSQPNV+ LILAGSADFKTELS SDMFDPRLQAKI Sbjct: 208 ATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKI 251