BLASTX nr result
ID: Jatropha_contig00018413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018413 (634 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01054.1| RNA-directed DNA polymerase (Reverse transcriptas... 100 2e-20 gb|EOX94716.1| RNA-directed DNA polymerase (Reverse transcriptas... 100 2e-20 gb|EOY10467.1| RNA-directed DNA polymerase (Reverse transcriptas... 100 2e-20 gb|EOY22161.1| RNA-directed DNA polymerase (Reverse transcriptas... 100 2e-20 gb|EOY03806.1| RNA-directed DNA polymerase [Theobroma cacao] 99 8e-20 gb|EOX94216.1| RNA-directed DNA polymerase [Theobroma cacao] 98 1e-19 gb|EOY19960.1| RNA-directed DNA polymerase, putative [Theobroma ... 101 2e-19 dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] 94 5e-19 gb|EOY20481.1| RNA-directed DNA polymerase (Reverse transcriptas... 99 9e-19 gb|EOY20987.1| RNA-directed DNA polymerase (Reverse transcriptas... 98 2e-18 gb|EOY21231.1| RNA-directed DNA polymerase [Theobroma cacao] 97 2e-18 gb|EOY15725.1| RNA-directed DNA polymerase (Reverse transcriptas... 96 4e-18 gb|EOY10681.1| Uncharacterized protein TCM_025982 [Theobroma cacao] 96 6e-18 gb|EOX95167.1| RNA-directed DNA polymerase (Reverse transcriptas... 95 9e-18 gb|EOY26501.1| RNA-directed DNA polymerase (Reverse transcriptas... 91 2e-17 gb|EOY21879.1| RNA-directed DNA polymerase (Reverse transcriptas... 91 2e-17 gb|EOY28052.1| RNA-directed DNA polymerase (Reverse transcriptas... 94 3e-17 emb|CAN65082.1| hypothetical protein VITISV_012370 [Vitis vinifera] 83 4e-17 gb|EOY09277.1| RNA-directed DNA polymerase (Reverse transcriptas... 93 4e-17 gb|EOY20400.1| RNA-directed DNA polymerase (Reverse transcriptas... 89 4e-17 >gb|EOY01054.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 1047 Score = 100 bits (250), Expect(2) = 2e-20 Identities = 49/119 (41%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 919 LPIEVEIPSLRVLK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 976 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HDLR K+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 977 KAHSRQFREGELVLKRILPNQHDLRGKWTPNWEGPFVVKKAFSGGALILAEMDGREFSN 1035 Score = 24.6 bits (52), Expect(2) = 2e-20 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 1032 EFSNPVNADAVKKYF 1046 >gb|EOX94716.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 642 Score = 100 bits (250), Expect(2) = 2e-20 Identities = 49/119 (41%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 514 LPIEVEIPSLRVLK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 571 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HDLR K+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 572 KAHSRQFREGELVLKRILPNQHDLRGKWTPNWEGPFVVKKAFSGGALILAEMDGREFSN 630 Score = 24.6 bits (52), Expect(2) = 2e-20 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 627 EFSNPVNADAVKKYF 641 >gb|EOY10467.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 139 Score = 100 bits (249), Expect(2) = 2e-20 Identities = 49/119 (41%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 5 LPIEVEIPSLRVLK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHRQLYQKRMMRAYDK 62 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HDLR K+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 63 KAHSRQFREGELVLKRILPNQHDLRGKWTPNWEGPFVVKKAFSGGALILAEMDGREFSN 121 Score = 25.0 bits (53), Expect(2) = 2e-20 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 118 EFSNPVNADAIKKYF 132 >gb|EOY22161.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 136 Score = 100 bits (249), Expect(2) = 2e-20 Identities = 49/119 (41%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 8 LPIEVEIPSLRVFK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 65 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HD RRK+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 66 KAHSRQFREGELVLKRILPNQHDPRRKWTPNWEGPFVVKKAFSGGALILAEMDGREFSN 124 Score = 24.6 bits (52), Expect(2) = 2e-20 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 121 EFSNPVNADAVKKYF 135 >gb|EOY03806.1| RNA-directed DNA polymerase [Theobroma cacao] Length = 386 Score = 98.6 bits (244), Expect(2) = 8e-20 Identities = 49/119 (41%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 258 LPIEVEIPSLRVLK--EVQLEETEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 315 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HD R K+ PNWEGPF+IKK FS GAL L++M+ N Sbjct: 316 KAHSRQFREGELVLKRILPNQHDPRGKWTPNWEGPFVIKKAFSGGALILAEMDGREFSN 374 Score = 24.6 bits (52), Expect(2) = 8e-20 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 371 EFSNPVNADAVKKYF 385 >gb|EOX94216.1| RNA-directed DNA polymerase [Theobroma cacao] Length = 460 Score = 98.2 bits (243), Expect(2) = 1e-19 Identities = 48/119 (40%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 332 LPIEVEIPSLRVLK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 389 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK++ PN HD R K+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 390 KAHSRQFREGELVLKRILPNQHDPRGKWTPNWEGPFVVKKAFSGGALILAEMDGREFSN 448 Score = 24.6 bits (52), Expect(2) = 1e-19 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 445 EFSNPVNADAVKKYF 459 >gb|EOY19960.1| RNA-directed DNA polymerase, putative [Theobroma cacao] Length = 2200 Score = 101 bits (251), Expect = 2e-19 Identities = 49/119 (41%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + ++K Sbjct: 1695 LPIEVEIPSLRVLK--EVQLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYDK 1752 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + HS+ +LVLK+ PN HD R K+ PNWEGPF++KK FS+GAL L++M+ M N Sbjct: 1753 KAHSRQFREGELVLKRTLPNQHDPRGKWTPNWEGPFVVKKAFSRGALILAEMDGMEFSN 1811 >dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] Length = 525 Score = 94.4 bits (233), Expect(2) = 5e-19 Identities = 49/119 (41%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+EVQS + + + + WAEN++ +L +DE L A Q+Y+RR+A+HFNK Sbjct: 397 LPIELEVQSARVIR--ESQISEANWAENYHLQLLGMDEKRLRAIHQTQVYQRRMARHFNK 454 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 RV + L LVLK++ + D R KF+P+W GP+++KKI S GA+ L+D++ + N Sbjct: 455 RVKDRKLEEGCLVLKEIRQPVIDPRGKFRPHWAGPYVLKKILSGGAVILTDLDGLEFTN 513 Score = 26.2 bits (56), Expect(2) = 5e-19 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +3 Query: 345 EFSEPINLDRLKKFYV 392 EF+ P NLD+LK+++V Sbjct: 510 EFTNPCNLDQLKRYFV 525 >gb|EOY20481.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 210 Score = 98.6 bits (244), Expect(2) = 9e-19 Identities = 47/119 (39%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 82 LPVEVEIPSLRVLM--ETKLEDAEWVRSRYEQLNLIEEKRLTALCHGQMYQRRMMRAYEK 139 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L+DM+ + PN Sbjct: 140 KVHPRQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILADMDGGDLPN 198 Score = 21.2 bits (43), Expect(2) = 9e-19 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 195 DLPNPINADAVKKYY 209 >gb|EOY20987.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 857 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/119 (40%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 699 LPVEVEIPSLRVLM--ETKLEDAEWVRSCYEQLNLIEEKRLAALCHGQMYQRRMMRAYEK 756 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH K +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L+DM+ + PN Sbjct: 757 KVHPKQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILADMDGGDLPN 815 >gb|EOY21231.1| RNA-directed DNA polymerase [Theobroma cacao] Length = 338 Score = 97.1 bits (240), Expect(2) = 2e-18 Identities = 47/119 (39%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 210 LPVEVEIPSLRVLM--ETELEDAEWVRSRYEQLNLIEEKRLAALCHGQMYQRRMMRAYEK 267 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L+DM+ + PN Sbjct: 268 KVHPRQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILADMDGGDLPN 326 Score = 21.2 bits (43), Expect(2) = 2e-18 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 323 DLPNPINADAVKKYY 337 >gb|EOY15725.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 284 Score = 96.3 bits (238), Expect(2) = 4e-18 Identities = 47/119 (39%), Positives = 77/119 (64%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 156 LPVEVEIPSLRVLM--ETKLEDAEWVCSRYEQLNLIEEKRLAALCHGQMYQRRMIRAYEK 213 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L+DM+ + PN Sbjct: 214 KVHPRQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILTDMDGGDLPN 272 Score = 21.2 bits (43), Expect(2) = 4e-18 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 269 DLPNPINADAVKKYY 283 >gb|EOY10681.1| Uncharacterized protein TCM_025982 [Theobroma cacao] Length = 828 Score = 96.3 bits (238), Expect = 6e-18 Identities = 47/119 (39%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + ++++W + Y++L L++E +L A Q+Y+RR + + K Sbjct: 691 LPVEVEIPSLRVLM--ETELEDAEWVRSRYEQLNLIEEKMLAALCHGQMYQRRRMRAYEK 748 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH K +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L++M+ + PN Sbjct: 749 KVHPKQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILANMDGGDLPN 807 >gb|EOX95167.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 210 Score = 95.1 bits (235), Expect(2) = 9e-18 Identities = 46/119 (38%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 82 LPVEVEIPSLRVLM--EAELEDAEWVRSRYEQLNLIEEKRLAALCHGQMYQRRMMRAYEK 139 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D R K+ PNWEGP+++KK FS GAL L++M+ + PN Sbjct: 140 KVHPRQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILANMDGGDLPN 198 Score = 21.2 bits (43), Expect(2) = 9e-18 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 195 DLPNPINADAVKKYY 209 >gb|EOY26501.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 353 Score = 90.9 bits (224), Expect(2) = 2e-17 Identities = 46/119 (38%), Positives = 73/119 (61%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W Y++L L++E L A QLY++R+ + + K Sbjct: 225 LPIEVEIPSLRVLK--EVQLEEAEWVNACYEQLNLIEEKRLTALCHGQLYQKRMIRAYGK 282 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 + H + +LVLK++ PN HD R K+ NWEGPF++KK FS GAL L++M+ N Sbjct: 283 KAHPRQFREGELVLKRILPNQHDPRGKWTLNWEGPFVVKKAFSGGALILAEMDGREFSN 341 Score = 24.6 bits (52), Expect(2) = 2e-17 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 338 EFSNPVNADAVKKYF 352 >gb|EOY21879.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H, putative [Theobroma cacao] Length = 433 Score = 90.5 bits (223), Expect(2) = 2e-17 Identities = 45/116 (38%), Positives = 71/116 (61%) Frame = +1 Query: 10 EIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNKRVH 189 E+E+ SL + K + ++W Y++L L++E L A QLY++R+ + + K+ H Sbjct: 308 EVEIPSLRVLK--EVHLEEAEWVNARYEQLNLIEEKRLTALCHGQLYQKRMMRAYGKKAH 365 Query: 190 SKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 S+ +LVLK++ PN HD K+ PNWEGPF++KK FS GAL L++M+ N Sbjct: 366 SRQFREGELVLKRILPNQHDPCGKWTPNWEGPFVVKKAFSGGALILTEMDGREFSN 421 Score = 24.6 bits (52), Expect(2) = 2e-17 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 418 EFSNPVNADAVKKYF 432 >gb|EOY28052.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 284 Score = 93.6 bits (231), Expect(2) = 3e-17 Identities = 45/119 (37%), Positives = 76/119 (63%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 156 LPVEVEIPSLRVLM--ETELEDAEWVRSRYEQLNLIEEKRLAALCHGQMYQRRMMRAYEK 213 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D + K+ PNWEGP+++KK FS GAL L++M+ + PN Sbjct: 214 KVHPRQFREGELVLKRILPNQTDFQGKWMPNWEGPYVVKKAFSGGALILANMDGGDLPN 272 Score = 21.2 bits (43), Expect(2) = 3e-17 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 269 DLPNPINTDAVKKYY 283 >emb|CAN65082.1| hypothetical protein VITISV_012370 [Vitis vinifera] Length = 1734 Score = 83.2 bits (204), Expect(2) = 4e-17 Identities = 44/113 (38%), Positives = 69/113 (61%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP EIE++SL + ++WA++HY +L+LLDE L A Q Y+R++ + F K Sbjct: 1606 LPVEIEMRSLRVAL--EQHISEAEWAQSHYDQLSLLDEKRLRAADHVQAYQRKMTRAFRK 1663 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDME 339 RV + DLVLK + I D R KF+P+W GP++I+ + +GA L+D++ Sbjct: 1664 RVKPRKFQRGDLVLKVLRGLISDPRGKFRPSWSGPYVIRDLTREGAAWLTDLD 1716 Score = 30.8 bits (68), Expect(2) = 4e-17 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 Query: 342 NEFSEPINLDRLKKFY 389 N+F EP+N+D+LKKFY Sbjct: 1718 NQFIEPVNVDQLKKFY 1733 >gb|EOY09277.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H, putative [Theobroma cacao] Length = 1560 Score = 92.8 bits (229), Expect(2) = 4e-17 Identities = 47/121 (38%), Positives = 77/121 (63%), Gaps = 2/121 (1%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + + ++++W + Y++L L++E L A Q+Y+RR+ + + K Sbjct: 1430 LPVEVEIPSLRVLM--ETKLEDAEWVRSRYEQLNLIEEKRLAALCHGQMYQRRMIRAYEK 1487 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGA--LKLSDMEAMNSP 354 +VH + +LVLK++ PN D R K+ PNWEGP+++KK FS GA L L+DM+ + P Sbjct: 1488 KVHPRQFREGELVLKRILPNQTDFRGKWMPNWEGPYVVKKAFSGGALILILTDMDGGDLP 1547 Query: 355 N 357 N Sbjct: 1548 N 1548 Score = 21.2 bits (43), Expect(2) = 4e-17 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 + PIN D +KK+Y Sbjct: 1545 DLPNPINTDAVKKYY 1559 >gb|EOY20400.1| RNA-directed DNA polymerase (Reverse transcriptase), Ribonuclease H [Theobroma cacao] Length = 210 Score = 89.4 bits (220), Expect(2) = 4e-17 Identities = 45/119 (37%), Positives = 72/119 (60%) Frame = +1 Query: 1 LPTEIEVQSLHITK*WNPRFQNSQWAENHYQELALLDE*ILNARFIDQLYKRRIAKHFNK 180 LP E+E+ SL + K + + ++W HY++L L++E L A LY++R+ + + K Sbjct: 82 LPIEVEIPSLRVLK--EVQLEEAEWVNIHYEQLNLIEEKKLTALCHGLLYQKRMMRAYGK 139 Query: 181 RVHSKLLIVRDLVLKQMWPNIHDLRRKFKPNWEGPFLIKKIFSKGALKLSDMEAMNSPN 357 +VH + +LVLK++ PN D R K+ NWE PF++KK FS+G L L+DM+ N Sbjct: 140 KVHPRQFQEGELVLKRILPNQQDPRGKWMSNWERPFVVKKAFSEGTLILADMDGKEFSN 198 Score = 24.6 bits (52), Expect(2) = 4e-17 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 345 EFSEPINLDRLKKFY 389 EFS P+N D +KK++ Sbjct: 195 EFSNPVNADAVKKYF 209