BLASTX nr result
ID: Jatropha_contig00018118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018118 (296 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516159.1| pentatricopeptide repeat-containing protein,... 62 7e-08 ref|XP_002324203.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 gb|ESR66202.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ESR66198.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ESR66197.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ESR66196.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ESR66195.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ESR66193.1| hypothetical protein CICLE_v10007851mg [Citrus cl... 59 6e-07 gb|ERP59791.1| hypothetical protein POPTR_0006s23550g [Populus t... 57 2e-06 ref|XP_002309456.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|ABK96374.1| unknown [Populus trichocarpa x Populus deltoides] 57 2e-06 gb|EMJ26957.1| hypothetical protein PRUPE_ppa005506mg [Prunus pe... 55 9e-06 >ref|XP_002516159.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544645|gb|EEF46161.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1439 Score = 62.0 bits (149), Expect = 7e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKGSQT+ TK++IP+KATALNPNAAEFVPF Sbjct: 1 MSLSKKGSQTNTTKLNIPSKATALNPNAAEFVPF 34 >ref|XP_002324203.1| predicted protein [Populus trichocarpa] gi|222865637|gb|EEF02768.1| small MutS related domain-containing family protein [Populus trichocarpa] Length = 583 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 M+LSKKGS T++TK+S+PNKAT LNPNAAEFVPF Sbjct: 1 MNLSKKGSLTNDTKLSLPNKATTLNPNAAEFVPF 34 >gb|ESR66202.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556196|gb|ESR66210.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 574 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ESR66198.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 476 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ESR66197.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556189|gb|ESR66203.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556190|gb|ESR66204.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556192|gb|ESR66206.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 440 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ESR66196.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556186|gb|ESR66200.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 512 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ESR66195.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 419 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ESR66193.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556180|gb|ESR66194.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556185|gb|ESR66199.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556187|gb|ESR66201.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556191|gb|ESR66205.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556193|gb|ESR66207.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556194|gb|ESR66208.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556195|gb|ESR66209.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556197|gb|ESR66211.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 429 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+Q S+TK+ PNKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTQISDTKLPSPNKATALNPNAAEFVPF 34 >gb|ERP59791.1| hypothetical protein POPTR_0006s23550g [Populus trichocarpa] Length = 443 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKGS T++TK+++P+KAT LNPNAAEFVPF Sbjct: 1 MSLSKKGSLTNDTKLNLPSKATTLNPNAAEFVPF 34 >ref|XP_002309456.1| predicted protein [Populus trichocarpa] gi|222855432|gb|EEE92979.1| small MutS related domain-containing family protein [Populus trichocarpa] Length = 581 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKGS T++TK+++P+KAT LNPNAAEFVPF Sbjct: 1 MSLSKKGSLTNDTKLNLPSKATTLNPNAAEFVPF 34 >gb|ABK96374.1| unknown [Populus trichocarpa x Populus deltoides] Length = 581 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKGS T++TK+++P+KAT LNPNAAEFVPF Sbjct: 1 MSLSKKGSLTNDTKLNLPSKATTLNPNAAEFVPF 34 >gb|EMJ26957.1| hypothetical protein PRUPE_ppa005506mg [Prunus persica] Length = 457 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 156 MSLSKKGSQTSNTKVSIPNKATALNPNAAEFVPF 257 MSLSKKG+ T++T++S NKATALNPNAAEFVPF Sbjct: 1 MSLSKKGTFTNDTRLSTANKATALNPNAAEFVPF 34