BLASTX nr result
ID: Jatropha_contig00018104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00018104 (169 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFJ04522.1| legumin B precursor, partial [Vernicia fordii] 67 2e-09 ref|XP_002524605.1| legumin A precursor, putative [Ricinus commu... 56 4e-06 ref|XP_002524606.1| legumin A precursor, putative [Ricinus commu... 55 9e-06 >gb|AFJ04522.1| legumin B precursor, partial [Vernicia fordii] Length = 415 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 2 DEFRQLYEGRREPGSGRHEGFSSRRRPEGRGTCNNLFCGLDSRLISEAFNIDKSLA 169 +EFRQ +E RE R E +S+ RR +G+CNNLFCG+DSRL++EAFNID SLA Sbjct: 120 EEFRQQFESGRE--GSRPEPYSTSRRKRQQGSCNNLFCGIDSRLLAEAFNIDLSLA 173 >ref|XP_002524605.1| legumin A precursor, putative [Ricinus communis] gi|223536158|gb|EEF37813.1| legumin A precursor, putative [Ricinus communis] Length = 508 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +2 Query: 2 DEFRQLYE--GRREPGSGRHEGFSSRRRPEGRGTCNNLFCGLDSRLISEAFNIDKSLA 169 DEF++ G RE G G S RRR G+CNN+FCG+DSRLI+EAFNI++ LA Sbjct: 218 DEFQKQSRRPGEREQGRYSLSGASERRR----GSCNNVFCGMDSRLIAEAFNINEQLA 271 >ref|XP_002524606.1| legumin A precursor, putative [Ricinus communis] gi|223536159|gb|EEF37814.1| legumin A precursor, putative [Ricinus communis] Length = 478 Score = 55.1 bits (131), Expect = 9e-06 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +2 Query: 2 DEFRQLYE--GRREPGSGRHEGFSSRRRPEGRGTCNNLFCGLDSRLISEAFNIDKSLA 169 DEF++ G RE G G S RRR G CNN+FCG+DSRLI+EAFNI++ LA Sbjct: 188 DEFQKQSRRPGEREQGRYSLSGDSERRR----GPCNNVFCGMDSRLIAEAFNINEQLA 241