BLASTX nr result
ID: Jatropha_contig00017995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017995 (167 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527559.1| cellular nucleic acid binding protein, putat... 65 1e-08 >ref|XP_002527559.1| cellular nucleic acid binding protein, putative [Ricinus communis] gi|223533051|gb|EEF34811.1| cellular nucleic acid binding protein, putative [Ricinus communis] Length = 497 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/57 (64%), Positives = 42/57 (73%), Gaps = 2/57 (3%) Frame = +2 Query: 2 KQKGKIGEENEEEMHVIALSRGH--DFQAHEDLSLKIVEKALLKREAKLAQNDNHCV 166 K+KGK ++ EEE VI LS G D +A+EDLSLKIVEKALL R AKLAQNDN V Sbjct: 6 KRKGKFDDKEEEEKAVIELSSGDEDDNEANEDLSLKIVEKALLMRAAKLAQNDNEIV 62