BLASTX nr result
ID: Jatropha_contig00017919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017919 (305 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533465.1| legumin B precursor, putative [Ricinus commu... 71 1e-10 ref|XP_002522726.1| 11S globulin subunit beta precursor, putativ... 68 1e-09 gb|AFJ04523.1| glutelin type-A 3 precursor, partial [Vernicia fo... 65 1e-08 ref|XP_002530185.1| 11S globulin subunit beta precursor, putativ... 64 3e-08 gb|AAF73008.1|AF262999_1 seed storage protein [Ricinus communis] 63 3e-08 ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricin... 63 3e-08 ref|XP_002278346.1| PREDICTED: legumin A-like isoform 1 [Vitis v... 56 5e-06 >ref|XP_002533465.1| legumin B precursor, putative [Ricinus communis] gi|223526680|gb|EEF28917.1| legumin B precursor, putative [Ricinus communis] Length = 403 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 NIFS +DEQ++A+AFN+NV++AR + G+NDNRG+IVSVE D E+L P RS Sbjct: 138 NIFSGIDEQMIAEAFNINVDLARKMRGENDNRGIIVSVEHDLEMLAPQRS 187 >ref|XP_002522726.1| 11S globulin subunit beta precursor, putative [Ricinus communis] gi|223537964|gb|EEF39577.1| 11S globulin subunit beta precursor, putative [Ricinus communis] Length = 386 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/50 (60%), Positives = 42/50 (84%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 N+FS +DE+ +A+AFN+NV++AR + G+ND RG+IVSVE D E+L PPRS Sbjct: 130 NVFSGMDERTIAEAFNINVDLARKLKGENDLRGIIVSVEHDLEMLAPPRS 179 >gb|AFJ04523.1| glutelin type-A 3 precursor, partial [Vernicia fordii] Length = 498 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 N+FS LDE+LLA AFN+N +VAR + +ND RG+IVSV R+ ELL P RS Sbjct: 233 NVFSGLDERLLAQAFNINTDVARRLKSENDKRGMIVSVVRELELLTPERS 282 >ref|XP_002530185.1| 11S globulin subunit beta precursor, putative [Ricinus communis] gi|223530304|gb|EEF32199.1| 11S globulin subunit beta precursor, putative [Ricinus communis] Length = 480 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/50 (56%), Positives = 42/50 (84%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 N+FS DE+L+++AFN++ E+AR + G++DNRG+IVSVE+D E+L P RS Sbjct: 228 NVFSGFDERLISEAFNIDTELARKMGGKSDNRGIIVSVEQDLEMLTPQRS 277 >gb|AAF73008.1|AF262999_1 seed storage protein [Ricinus communis] Length = 353 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/50 (54%), Positives = 41/50 (82%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 N+FS +DE+++A++FN+N ++AR + G+ND RG+IVSVE D E+L P RS Sbjct: 98 NVFSGMDERVIAESFNINTDLARKLRGENDLRGIIVSVEHDLEMLAPQRS 147 >ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricinus communis] gi|223526681|gb|EEF28918.1| glutelin type-A 3 precursor, putative [Ricinus communis] Length = 497 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/50 (54%), Positives = 41/50 (82%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPRS 250 N+FS +DE+++A++FN+N ++AR + G+ND RG+IVSVE D E+L P RS Sbjct: 242 NVFSGMDERVIAESFNINTDLARKLRGENDLRGIIVSVEHDLEMLAPQRS 291 >ref|XP_002278346.1| PREDICTED: legumin A-like isoform 1 [Vitis vinifera] Length = 500 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +2 Query: 101 NIFSSLDEQLLADAFNVNVEVAR*IIGQNDNRGLIVSVERDFELLFPPR 247 NIFS D Q LA+AFNV+V++ R + GQND RG IV VE + L PPR Sbjct: 251 NIFSGFDAQQLAEAFNVDVQLIRKLQGQNDRRGNIVRVEGGLQALLPPR 299