BLASTX nr result
ID: Jatropha_contig00017906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017906 (404 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 123 8e-44 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 123 bits (309), Expect(3) = 8e-44 Identities = 63/78 (80%), Positives = 66/78 (84%) Frame = -3 Query: 402 RHEDKVGYDRSYESLFQFSWPQARAKIVGDQKAILLPLIDEFSEVRMDDPDWMRLRKRAI 223 RHE KVGY +S+ESLFQFS PQARA IV DQKAILLPLIDEFSEV DDPD MRLR RA Sbjct: 89 RHEVKVGYVQSFESLFQFSRPQARAMIVDDQKAILLPLIDEFSEVLSDDPDQMRLRMRAF 148 Query: 222 VLSLLSGFLFNKDPGFGE 169 V LLSGFLFNKDPGFG+ Sbjct: 149 VFCLLSGFLFNKDPGFGD 166 Score = 57.4 bits (137), Expect(3) = 8e-44 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 88 ALDRAVIGFEDWTVSPIILQVLLLSSFPY 2 +LDRA +GFEDWTVSPIILQVLLLSSFPY Sbjct: 193 SLDRAALGFEDWTVSPIILQVLLLSSFPY 221 Score = 42.7 bits (99), Expect(3) = 8e-44 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -1 Query: 173 GNLRFCLMIRQMEDMGSKGGKELAETIRS 87 G+LRFC MIRQMEDM GG L+ETIRS Sbjct: 165 GDLRFCPMIRQMEDMSCIGGIVLSETIRS 193