BLASTX nr result
ID: Jatropha_contig00017862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017862 (261 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatul... 79 5e-13 ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncat... 76 5e-12 ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatul... 76 5e-12 gb|AGS12748.1| ribosomal protein L23 (chloroplast) [Quiina pteri... 56 4e-06 gb|AGS12746.1| ribosomal protein L23 (chloroplast) [Pera bicolor] 56 4e-06 gb|AGS12740.1| ribosomal protein L23 (chloroplast) [Klainedoxa g... 56 4e-06 gb|AGS12735.1| ribosomal protein L23 (chloroplast) [Erythroxylum... 56 4e-06 ref|YP_636341.1| ribosomal protein L23 [Eucalyptus globulus subs... 56 4e-06 emb|CAA47045.1| rpl23 [Arabidopsis thaliana] 56 4e-06 gb|AFU94298.1| Rpl23, partial (chloroplast) [Quiina glaziovii] 56 4e-06 gb|AFU94294.1| Rpl23, partial (chloroplast) [Pera bumeliifolia] 56 4e-06 gb|AFU94289.1| Rpl23, partial (chloroplast) [Lacistema robustum] 56 4e-06 gb|AFU94288.1| Rpl23, partial (chloroplast) [Ixonanthes sp. CCD-... 56 4e-06 gb|AFU94287.1| Rpl23, partial (chloroplast) [Irvingia malayana] 56 4e-06 gb|AFU94278.1| Rpl23, partial (chloroplast) [Erythroxylum areola... 56 4e-06 gb|AFU94274.1| Rpl23, partial (chloroplast) [Clusia rosea] gi|40... 56 4e-06 gb|AFU94271.1| Rpl23, partial (chloroplast) [Casearia nitida] 56 4e-06 ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina... 56 4e-06 gb|AEK71453.1| ribosomal protein L23 [Clidemia dentata] 56 4e-06 gb|AEK71432.1| ribosomal protein L23 [Carica papaya] 56 4e-06 >ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355506963|gb|AES88105.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 137 ILIETRTHREENRFMDGTKYAVFTDKSIRLLGKNQYTFNVE 259 I IETRTHREENRFM+G KYA+FTDKSIRLLGKNQYTFNVE Sbjct: 23 IRIETRTHREENRFMNGIKYAIFTDKSIRLLGKNQYTFNVE 63 >ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncatula] gi|355507116|gb|AES88258.1| 50S ribosomal protein L2-B [Medicago truncatula] Length = 382 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 137 ILIETRTHREENRFMDGTKYAVFTDKSIRLLGKNQYTFNVE 259 I IETRTHREENRFM+G K A+FTDKSIRLLGKNQYTFNVE Sbjct: 23 IRIETRTHREENRFMNGIKNAIFTDKSIRLLGKNQYTFNVE 63 >ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355488630|gb|AES69833.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 137 ILIETRTHREENRFMDGTKYAVFTDKSIRLLGKNQYTFNVE 259 I IETRTHREENRFM+G K A+FTDKSIRLLGKNQYTFNVE Sbjct: 23 IRIETRTHREENRFMNGIKNAIFTDKSIRLLGKNQYTFNVE 63 >gb|AGS12748.1| ribosomal protein L23 (chloroplast) [Quiina pteridophylla] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AGS12746.1| ribosomal protein L23 (chloroplast) [Pera bicolor] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AGS12740.1| ribosomal protein L23 (chloroplast) [Klainedoxa gabonensis] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AGS12735.1| ribosomal protein L23 (chloroplast) [Erythroxylum sp. CD-2013] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >ref|YP_636341.1| ribosomal protein L23 [Eucalyptus globulus subsp. globulus] gi|108802706|ref|YP_636362.1| ribosomal protein L23 [Eucalyptus globulus subsp. globulus] gi|309322487|ref|YP_003934001.1| ribosomal protein L23 [Eucalyptus grandis] gi|309322505|ref|YP_003934018.1| ribosomal protein L23 [Eucalyptus grandis] gi|545716287|ref|YP_008575155.1| ribosomal protein L23 (chloroplast) [Eucalyptus obliqua] gi|545716308|ref|YP_008575176.1| ribosomal protein L23 (chloroplast) [Eucalyptus obliqua] gi|545716373|ref|YP_008575240.1| ribosomal protein L23 (chloroplast) [Eucalyptus radiata] gi|545716394|ref|YP_008575261.1| ribosomal protein L23 (chloroplast) [Eucalyptus radiata] gi|545716459|ref|YP_008575325.1| ribosomal protein L23 (chloroplast) [Eucalyptus delegatensis] gi|545716480|ref|YP_008575346.1| ribosomal protein L23 (chloroplast) [Eucalyptus delegatensis] gi|545716545|ref|YP_008575410.1| ribosomal protein L23 (chloroplast) [Eucalyptus verrucata] gi|545716566|ref|YP_008575431.1| ribosomal protein L23 (chloroplast) [Eucalyptus verrucata] gi|545716631|ref|YP_008575495.1| ribosomal protein L23 (chloroplast) [Eucalyptus baxteri] gi|545716652|ref|YP_008575516.1| ribosomal protein L23 (chloroplast) [Eucalyptus baxteri] gi|545716717|ref|YP_008575580.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversifolia] gi|545716738|ref|YP_008575601.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversifolia] gi|545716803|ref|YP_008575665.1| ribosomal protein L23 (chloroplast) [Eucalyptus sieberi] gi|545716824|ref|YP_008575686.1| ribosomal protein L23 (chloroplast) [Eucalyptus sieberi] gi|545716889|ref|YP_008575750.1| ribosomal protein L23 (chloroplast) [Eucalyptus elata] gi|545716910|ref|YP_008575771.1| ribosomal protein L23 (chloroplast) [Eucalyptus elata] gi|545716975|ref|YP_008575835.1| ribosomal protein L23 (chloroplast) [Eucalyptus regnans] gi|545716996|ref|YP_008575856.1| ribosomal protein L23 (chloroplast) [Eucalyptus regnans] gi|545717061|ref|YP_008575920.1| ribosomal protein L23 (chloroplast) [Eucalyptus umbra] gi|545717082|ref|YP_008575941.1| ribosomal protein L23 (chloroplast) [Eucalyptus umbra] gi|545717147|ref|YP_008576005.1| ribosomal protein L23 (chloroplast) [Eucalyptus cloeziana] gi|545717168|ref|YP_008576026.1| ribosomal protein L23 (chloroplast) [Eucalyptus cloeziana] gi|545717233|ref|YP_008576090.1| ribosomal protein L23 (chloroplast) [Eucalyptus patens] gi|545717254|ref|YP_008576111.1| ribosomal protein L23 (chloroplast) [Eucalyptus patens] gi|545717319|ref|YP_008576175.1| ribosomal protein L23 (chloroplast) [Eucalyptus marginata] gi|545717340|ref|YP_008576196.1| ribosomal protein L23 (chloroplast) [Eucalyptus marginata] gi|545717405|ref|YP_008576260.1| ribosomal protein L23 (chloroplast) [Eucalyptus curtisii] gi|545717426|ref|YP_008576281.1| ribosomal protein L23 (chloroplast) [Eucalyptus curtisii] gi|545717491|ref|YP_008576345.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|545717512|ref|YP_008576366.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|545717577|ref|YP_008576430.1| ribosomal protein L23 (chloroplast) [Eucalyptus polybractea] gi|545717598|ref|YP_008576451.1| ribosomal protein L23 (chloroplast) [Eucalyptus polybractea] gi|545717663|ref|YP_008576515.1| ribosomal protein L23 (chloroplast) [Eucalyptus cladocalyx] gi|545717684|ref|YP_008576536.1| ribosomal protein L23 (chloroplast) [Eucalyptus cladocalyx] gi|545717749|ref|YP_008576600.1| ribosomal protein L23 (chloroplast) [Eucalyptus nitens] gi|545717770|ref|YP_008576621.1| ribosomal protein L23 (chloroplast) [Eucalyptus nitens] gi|545717835|ref|YP_008576685.1| ribosomal protein L23 (chloroplast) [Eucalyptus aromaphloia] gi|545717856|ref|YP_008576706.1| ribosomal protein L23 (chloroplast) [Eucalyptus aromaphloia] gi|545717921|ref|YP_008576770.1| ribosomal protein L23 (chloroplast) [Eucalyptus saligna] gi|545717942|ref|YP_008576791.1| ribosomal protein L23 (chloroplast) [Eucalyptus saligna] gi|545718007|ref|YP_008576855.1| ribosomal protein L23 (chloroplast) [Eucalyptus camaldulensis] gi|545718028|ref|YP_008576876.1| ribosomal protein L23 (chloroplast) [Eucalyptus camaldulensis] gi|545718093|ref|YP_008576940.1| ribosomal protein L23 (chloroplast) [Eucalyptus deglupta] gi|545718114|ref|YP_008576961.1| ribosomal protein L23 (chloroplast) [Eucalyptus deglupta] gi|545718179|ref|YP_008577025.1| ribosomal protein L23 (chloroplast) [Eucalyptus spathulata] gi|545718200|ref|YP_008577046.1| ribosomal protein L23 (chloroplast) [Eucalyptus spathulata] gi|545718265|ref|YP_008577110.1| ribosomal protein L23 (chloroplast) [Eucalyptus torquata] gi|545718286|ref|YP_008577131.1| ribosomal protein L23 (chloroplast) [Eucalyptus torquata] gi|545718351|ref|YP_008577195.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversicolor] gi|545718372|ref|YP_008577216.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversicolor] gi|545718437|ref|YP_008577280.1| ribosomal protein L23 (chloroplast) [Eucalyptus salmonophloia] gi|545718458|ref|YP_008577301.1| ribosomal protein L23 (chloroplast) [Eucalyptus salmonophloia] gi|545718523|ref|YP_008577365.1| ribosomal protein L23 (chloroplast) [Eucalyptus microcorys] gi|545718544|ref|YP_008577386.1| ribosomal protein L23 (chloroplast) [Eucalyptus microcorys] gi|545718609|ref|YP_008577450.1| ribosomal protein L23 (chloroplast) [Eucalyptus guilfoylei] gi|545718630|ref|YP_008577471.1| ribosomal protein L23 (chloroplast) [Eucalyptus guilfoylei] gi|545718781|ref|YP_008577620.1| ribosomal protein L23 (chloroplast) [Corymbia gummifera] gi|545718802|ref|YP_008577641.1| ribosomal protein L23 (chloroplast) [Corymbia gummifera] gi|545718867|ref|YP_008577705.1| ribosomal protein L23 (chloroplast) [Corymbia maculata] gi|545718888|ref|YP_008577726.1| ribosomal protein L23 (chloroplast) [Corymbia maculata] gi|545718953|ref|YP_008577790.1| ribosomal protein L23 (chloroplast) [Corymbia eximia] gi|545718974|ref|YP_008577811.1| ribosomal protein L23 (chloroplast) [Corymbia eximia] gi|545719039|ref|YP_008577875.1| ribosomal protein L23 (chloroplast) [Corymbia tessellaris] gi|545719060|ref|YP_008577896.1| ribosomal protein L23 (chloroplast) [Corymbia tessellaris] gi|545719125|ref|YP_008577960.1| ribosomal protein L23 (chloroplast) [Angophora floribunda] gi|545719146|ref|YP_008577981.1| ribosomal protein L23 (chloroplast) [Angophora floribunda] gi|545719211|ref|YP_008578045.1| ribosomal protein L23 (chloroplast) [Angophora costata] gi|545719232|ref|YP_008578066.1| ribosomal protein L23 (chloroplast) [Angophora costata] gi|545719297|ref|YP_008578215.1| ribosomal protein L23 (chloroplast) [Stockwellia quadrifida] gi|545719318|ref|YP_008578236.1| ribosomal protein L23 (chloroplast) [Stockwellia quadrifida] gi|545719469|ref|YP_008578130.1| ribosomal protein L23 (chloroplast) [Allosyncarpia ternata] gi|545719490|ref|YP_008578151.1| ribosomal protein L23 (chloroplast) [Allosyncarpia ternata] gi|122249135|sp|Q49KT5.1|RK23_EUCGG RecName: Full=50S ribosomal protein L23, chloroplastic gi|60460849|gb|AAX21069.1| ribosomal protein L23 [Eucalyptus globulus subsp. globulus] gi|60460872|gb|AAX21092.1| ribosomal protein L23 [Eucalyptus globulus subsp. globulus] gi|296936714|gb|ADH94386.1| ribosomal protein L23 [Syzygium cumini] gi|296936733|gb|ADH94405.1| ribosomal protein L23 [Syzygium cumini] gi|308223321|gb|ADO23629.1| ribosomal protein L23 [Eucalyptus grandis] gi|308223339|gb|ADO23647.1| ribosomal protein L23 [Eucalyptus grandis] gi|340842499|gb|AEK78158.1| ribosomal protein L23 [Myrtus communis] gi|442566195|gb|AGC56394.1| ribosomal protein L23 (chloroplast) [Eucalyptus obliqua] gi|442566216|gb|AGC56415.1| ribosomal protein L23 (chloroplast) [Eucalyptus obliqua] gi|442566281|gb|AGC56479.1| ribosomal protein L23 (chloroplast) [Eucalyptus radiata] gi|442566302|gb|AGC56500.1| ribosomal protein L23 (chloroplast) [Eucalyptus radiata] gi|442566367|gb|AGC56564.1| ribosomal protein L23 (chloroplast) [Eucalyptus delegatensis] gi|442566388|gb|AGC56585.1| ribosomal protein L23 (chloroplast) [Eucalyptus delegatensis] gi|442566453|gb|AGC56649.1| ribosomal protein L23 (chloroplast) [Eucalyptus verrucata] gi|442566474|gb|AGC56670.1| ribosomal protein L23 (chloroplast) [Eucalyptus verrucata] gi|442566539|gb|AGC56734.1| ribosomal protein L23 (chloroplast) [Eucalyptus baxteri] gi|442566560|gb|AGC56755.1| ribosomal protein L23 (chloroplast) [Eucalyptus baxteri] gi|442566625|gb|AGC56819.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversifolia] gi|442566646|gb|AGC56840.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversifolia] gi|442566711|gb|AGC56904.1| ribosomal protein L23 (chloroplast) [Eucalyptus sieberi] gi|442566732|gb|AGC56925.1| ribosomal protein L23 (chloroplast) [Eucalyptus sieberi] gi|442566797|gb|AGC56989.1| ribosomal protein L23 (chloroplast) [Eucalyptus elata] gi|442566818|gb|AGC57010.1| ribosomal protein L23 (chloroplast) [Eucalyptus elata] gi|442566883|gb|AGC57074.1| ribosomal protein L23 (chloroplast) [Eucalyptus regnans] gi|442566904|gb|AGC57095.1| ribosomal protein L23 (chloroplast) [Eucalyptus regnans] gi|442566969|gb|AGC57159.1| ribosomal protein L23 (chloroplast) [Eucalyptus umbra] gi|442566990|gb|AGC57180.1| ribosomal protein L23 (chloroplast) [Eucalyptus umbra] gi|442567055|gb|AGC57244.1| ribosomal protein L23 (chloroplast) [Eucalyptus cloeziana] gi|442567076|gb|AGC57265.1| ribosomal protein L23 (chloroplast) [Eucalyptus cloeziana] gi|442567141|gb|AGC57329.1| ribosomal protein L23 (chloroplast) [Eucalyptus patens] gi|442567162|gb|AGC57350.1| ribosomal protein L23 (chloroplast) [Eucalyptus patens] gi|442567227|gb|AGC57414.1| ribosomal protein L23 (chloroplast) [Eucalyptus marginata] gi|442567248|gb|AGC57435.1| ribosomal protein L23 (chloroplast) [Eucalyptus marginata] gi|442567313|gb|AGC57499.1| ribosomal protein L23 (chloroplast) [Eucalyptus curtisii] gi|442567334|gb|AGC57520.1| ribosomal protein L23 (chloroplast) [Eucalyptus curtisii] gi|442567399|gb|AGC57584.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|442567420|gb|AGC57605.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|442567485|gb|AGC57669.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|442567506|gb|AGC57690.1| ribosomal protein L23 (chloroplast) [Eucalyptus melliodora] gi|442567571|gb|AGC57754.1| ribosomal protein L23 (chloroplast) [Eucalyptus polybractea] gi|442567592|gb|AGC57775.1| ribosomal protein L23 (chloroplast) [Eucalyptus polybractea] gi|442567657|gb|AGC57839.1| ribosomal protein L23 (chloroplast) [Eucalyptus cladocalyx] gi|442567678|gb|AGC57860.1| ribosomal protein L23 (chloroplast) [Eucalyptus cladocalyx] gi|442567743|gb|AGC57924.1| ribosomal protein L23 (chloroplast) [Eucalyptus globulus] gi|442567764|gb|AGC57945.1| ribosomal protein L23 (chloroplast) [Eucalyptus globulus] gi|442567829|gb|AGC58009.1| ribosomal protein L23 (chloroplast) [Eucalyptus nitens] gi|442567850|gb|AGC58030.1| ribosomal protein L23 (chloroplast) [Eucalyptus nitens] gi|442567915|gb|AGC58094.1| ribosomal protein L23 (chloroplast) [Eucalyptus aromaphloia] gi|442567936|gb|AGC58115.1| ribosomal protein L23 (chloroplast) [Eucalyptus aromaphloia] gi|442568001|gb|AGC58179.1| ribosomal protein L23 (chloroplast) [Eucalyptus saligna] gi|442568022|gb|AGC58200.1| ribosomal protein L23 (chloroplast) [Eucalyptus saligna] gi|442568087|gb|AGC58264.1| ribosomal protein L23 (chloroplast) [Eucalyptus camaldulensis] gi|442568108|gb|AGC58285.1| ribosomal protein L23 (chloroplast) [Eucalyptus camaldulensis] gi|442568173|gb|AGC58349.1| ribosomal protein L23 (chloroplast) [Eucalyptus deglupta] gi|442568194|gb|AGC58370.1| ribosomal protein L23 (chloroplast) [Eucalyptus deglupta] gi|442568259|gb|AGC58434.1| ribosomal protein L23 (chloroplast) [Eucalyptus spathulata] gi|442568280|gb|AGC58455.1| ribosomal protein L23 (chloroplast) [Eucalyptus spathulata] gi|442568345|gb|AGC58519.1| ribosomal protein L23 (chloroplast) [Eucalyptus torquata] gi|442568366|gb|AGC58540.1| ribosomal protein L23 (chloroplast) [Eucalyptus torquata] gi|442568431|gb|AGC58604.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversicolor] gi|442568452|gb|AGC58625.1| ribosomal protein L23 (chloroplast) [Eucalyptus diversicolor] gi|442568517|gb|AGC58689.1| ribosomal protein L23 (chloroplast) [Eucalyptus salmonophloia] gi|442568538|gb|AGC58710.1| ribosomal protein L23 (chloroplast) [Eucalyptus salmonophloia] gi|442568603|gb|AGC58774.1| ribosomal protein L23 (chloroplast) [Eucalyptus microcorys] gi|442568624|gb|AGC58795.1| ribosomal protein L23 (chloroplast) [Eucalyptus microcorys] gi|442568689|gb|AGC58859.1| ribosomal protein L23 (chloroplast) [Eucalyptus guilfoylei] gi|442568710|gb|AGC58880.1| ribosomal protein L23 (chloroplast) [Eucalyptus guilfoylei] gi|442568861|gb|AGC59029.1| ribosomal protein L23 (chloroplast) [Corymbia gummifera] gi|442568882|gb|AGC59050.1| ribosomal protein L23 (chloroplast) [Corymbia gummifera] gi|442568947|gb|AGC59114.1| ribosomal protein L23 (chloroplast) [Corymbia maculata] gi|442568968|gb|AGC59135.1| ribosomal protein L23 (chloroplast) [Corymbia maculata] gi|442569033|gb|AGC59199.1| ribosomal protein L23 (chloroplast) [Corymbia eximia] gi|442569054|gb|AGC59220.1| ribosomal protein L23 (chloroplast) [Corymbia eximia] gi|442569119|gb|AGC59284.1| ribosomal protein L23 (chloroplast) [Corymbia tessellaris] gi|442569140|gb|AGC59305.1| ribosomal protein L23 (chloroplast) [Corymbia tessellaris] gi|442569205|gb|AGC59369.1| ribosomal protein L23 (chloroplast) [Angophora floribunda] gi|442569226|gb|AGC59390.1| ribosomal protein L23 (chloroplast) [Angophora floribunda] gi|442569291|gb|AGC59454.1| ribosomal protein L23 (chloroplast) [Angophora costata] gi|442569312|gb|AGC59475.1| ribosomal protein L23 (chloroplast) [Angophora costata] gi|442569377|gb|AGC59539.1| ribosomal protein L23 (chloroplast) [Allosyncarpia ternata] gi|442569398|gb|AGC59560.1| ribosomal protein L23 (chloroplast) [Allosyncarpia ternata] gi|442569463|gb|AGC59624.1| ribosomal protein L23 (chloroplast) [Stockwellia quadrifida] gi|442569484|gb|AGC59645.1| ribosomal protein L23 (chloroplast) [Stockwellia quadrifida] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >emb|CAA47045.1| rpl23 [Arabidopsis thaliana] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94298.1| Rpl23, partial (chloroplast) [Quiina glaziovii] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94294.1| Rpl23, partial (chloroplast) [Pera bumeliifolia] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94289.1| Rpl23, partial (chloroplast) [Lacistema robustum] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94288.1| Rpl23, partial (chloroplast) [Ixonanthes sp. CCD-2012] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94287.1| Rpl23, partial (chloroplast) [Irvingia malayana] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94278.1| Rpl23, partial (chloroplast) [Erythroxylum areolatum] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94274.1| Rpl23, partial (chloroplast) [Clusia rosea] gi|408898805|gb|AFU94275.1| Rpl23, partial (chloroplast) [Ctenolophon englerianus] gi|408898813|gb|AFU94279.1| Rpl23, partial (chloroplast) [Euphorbia maculata] gi|408898819|gb|AFU94282.1| Rpl23, partial (chloroplast) [Garcinia mangostana] gi|408898835|gb|AFU94290.1| Rpl23, partial (chloroplast) [Mammea americana] gi|408898847|gb|AFU94296.1| Rpl23, partial (chloroplast) [Ploiarium sp. CCD-2012] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AFU94271.1| Rpl23, partial (chloroplast) [Casearia nitida] Length = 97 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|377829934|ref|YP_005296161.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|340806942|gb|AEK71570.1| ribosomal protein L23 [Spiraea tomentosa] gi|371532663|gb|AEX31773.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] gi|371532682|gb|AEX31792.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AEK71453.1| ribosomal protein L23 [Clidemia dentata] Length = 92 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27 >gb|AEK71432.1| ribosomal protein L23 [Carica papaya] Length = 93 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 179 MDGTKYAVFTDKSIRLLGKNQYTFNVE 259 MDG KYAVFTDKSIRLLGKNQYTFNVE Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVE 27