BLASTX nr result
ID: Jatropha_contig00017757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017757 (312 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arab... 50 1e-11 gb|ABM54183.1| aquaporin [Jatropha curcas] 65 1e-08 gb|ACB87734.1| aquaporin [Manihot esculenta] 59 8e-07 ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis... 57 2e-06 gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza] 55 7e-06 >ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. lyrata] gi|297314944|gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. lyrata] Length = 280 Score = 50.1 bits (118), Expect(2) = 1e-11 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +2 Query: 155 EIKLWSFY*ALIAEFIDDLLFLYLTVPTVTGH 250 E+K WSFY ALIAEFI LLFLY+TV TV GH Sbjct: 30 ELKSWSFYRALIAEFIATLLFLYVTVATVIGH 61 Score = 45.1 bits (105), Expect(2) = 1e-11 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = +1 Query: 67 MANEVSEQTHTTHAKDYVDPPPAPLIDM 150 M+ EVSE+ T H KDYVDPPPAP DM Sbjct: 1 MSKEVSEEGKTHHGKDYVDPPPAPFFDM 28 >gb|ABM54183.1| aquaporin [Jatropha curcas] Length = 280 Score = 64.7 bits (156), Expect = 1e-08 Identities = 39/77 (50%), Positives = 45/77 (58%) Frame = +1 Query: 67 MANEVSEQTHTTHAKDYVDPPPAPLIDMD*DQTLVFLLSFNS*VHRRSPFPLPNCTHCNW 246 MA EVSE+T TTHAKDYVDPPPAPLIDM + F + + F L Sbjct: 1 MAKEVSEETQTTHAKDYVDPPPAPLIDMAEIKLWSFYRALIAEFIATLLF-LYITVATVI 59 Query: 247 AYNIKIDPCGGVGLLGV 297 Y + DPCGGVGLLG+ Sbjct: 60 GYKKQTDPCGGVGLLGI 76 >gb|ACB87734.1| aquaporin [Manihot esculenta] Length = 280 Score = 58.5 bits (140), Expect = 8e-07 Identities = 35/77 (45%), Positives = 43/77 (55%) Frame = +1 Query: 67 MANEVSEQTHTTHAKDYVDPPPAPLIDMD*DQTLVFLLSFNS*VHRRSPFPLPNCTHCNW 246 MA +V+E+T TH KDYVDPPPAPLIDM + F + + F L Sbjct: 1 MAKDVTEETQPTHGKDYVDPPPAPLIDMAEIKLWSFYRALIAEFIATLLF-LYITVATVI 59 Query: 247 AYNIKIDPCGGVGLLGV 297 Y + DPCGGVGLLG+ Sbjct: 60 GYKKQTDPCGGVGLLGI 76 >ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis] gi|38198154|emb|CAE53883.1| aquaporin [Ricinus communis] gi|223539560|gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis] Length = 280 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/77 (42%), Positives = 43/77 (55%) Frame = +1 Query: 67 MANEVSEQTHTTHAKDYVDPPPAPLIDMD*DQTLVFLLSFNS*VHRRSPFPLPNCTHCNW 246 MA +V E+T T+H KDYVDPPPAPL+DM + F + + F L Sbjct: 1 MAKDVGEETQTSHGKDYVDPPPAPLVDMAELKLWSFYRALIAEFIATLLF-LYITVATVI 59 Query: 247 AYNIKIDPCGGVGLLGV 297 Y + DPCGGVG+LG+ Sbjct: 60 GYKKQTDPCGGVGILGI 76 >gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza] Length = 280 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 149 WTEIKLWSFY*ALIAEFIDDLLFLYLTVPTVTGH 250 W E+KLWSFY A+IAEFI LLFLY+T+ TV GH Sbjct: 28 WAEVKLWSFYRAVIAEFIATLLFLYVTIATVIGH 61