BLASTX nr result
ID: Jatropha_contig00017689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017689 (198 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525309.1| receptor protein kinase, putative [Ricinus c... 77 2e-12 >ref|XP_002525309.1| receptor protein kinase, putative [Ricinus communis] gi|223535368|gb|EEF37042.1| receptor protein kinase, putative [Ricinus communis] Length = 603 Score = 77.0 bits (188), Expect = 2e-12 Identities = 40/55 (72%), Positives = 42/55 (76%) Frame = +1 Query: 34 YFGFYRKRKEKGATLLSTVSPDPSGQGLRAPGSNSDKPVESTGLAPSPGLTGITV 198 YFG YRK+K KGA L S D S L+ PGSNSDKPVESTGLAPSPGLTGITV Sbjct: 237 YFGLYRKKKVKGALL----SQDISAHALQGPGSNSDKPVESTGLAPSPGLTGITV 287