BLASTX nr result
ID: Jatropha_contig00017668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017668 (210 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR40538.1| hypothetical protein CICLE_v10024683mg [Citrus cl... 147 2e-33 gb|EOY25846.1| Pre-mRNA-processing-splicing factor isoform 4 [Th... 147 2e-33 gb|EOY25845.1| Pre-mRNA-processing-splicing factor isoform 3, pa... 147 2e-33 gb|EOY25843.1| Pre-mRNA-processing-splicing factor isoform 1 [Th... 147 2e-33 ref|XP_002517654.1| Pre-mRNA-processing-splicing factor, putativ... 147 2e-33 ref|XP_002327417.1| predicted protein [Populus trichocarpa] gi|5... 147 2e-33 ref|XP_004158783.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro... 146 2e-33 ref|XP_004135844.1| PREDICTED: pre-mRNA-processing-splicing fact... 146 2e-33 ref|XP_003632761.1| PREDICTED: pre-mRNA-processing-splicing fact... 146 2e-33 ref|XP_003632762.1| PREDICTED: pre-mRNA-processing-splicing fact... 146 2e-33 emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] 146 2e-33 ref|XP_006361638.1| PREDICTED: pre-mRNA-processing-splicing fact... 146 3e-33 gb|EMT32957.1| Pre-mRNA-processing-splicing factor 8 [Aegilops t... 146 3e-33 gb|EMT11384.1| Pre-mRNA-processing-splicing factor 8 [Aegilops t... 146 3e-33 gb|EMS52734.1| Pre-mRNA-processing-splicing factor 8 [Triticum u... 146 3e-33 ref|XP_004242824.1| PREDICTED: pre-mRNA-processing-splicing fact... 146 3e-33 gb|ESW22754.1| hypothetical protein PHAVU_005G178600g [Phaseolus... 145 5e-33 ref|XP_003546924.1| PREDICTED: pre-mRNA-processing-splicing fact... 145 5e-33 ref|XP_004303294.1| PREDICTED: pre-mRNA-processing-splicing fact... 145 7e-33 gb|EMJ16092.1| hypothetical protein PRUPE_ppa000032mg [Prunus pe... 145 7e-33 >gb|ESR40538.1| hypothetical protein CICLE_v10024683mg [Citrus clementina] Length = 2357 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 94 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 153 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 154 VVEPIYLAQ 162 >gb|EOY25846.1| Pre-mRNA-processing-splicing factor isoform 4 [Theobroma cacao] Length = 2007 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 92 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 151 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 152 VVEPIYLAQ 160 >gb|EOY25845.1| Pre-mRNA-processing-splicing factor isoform 3, partial [Theobroma cacao] Length = 2126 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 92 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 151 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 152 VVEPIYLAQ 160 >gb|EOY25843.1| Pre-mRNA-processing-splicing factor isoform 1 [Theobroma cacao] gi|508778588|gb|EOY25844.1| Pre-mRNA-processing-splicing factor isoform 1 [Theobroma cacao] Length = 2354 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 92 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 151 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 152 VVEPIYLAQ 160 >ref|XP_002517654.1| Pre-mRNA-processing-splicing factor, putative [Ricinus communis] gi|223543286|gb|EEF44818.1| Pre-mRNA-processing-splicing factor, putative [Ricinus communis] Length = 2376 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 96 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 155 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 156 VVEPIYLAQ 164 >ref|XP_002327417.1| predicted protein [Populus trichocarpa] gi|550342246|gb|ERP63102.1| embryo defective 14 family protein [Populus trichocarpa] Length = 2357 Score = 147 bits (370), Expect = 2e-33 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 94 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 153 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 154 VVEPIYLAQ 162 >ref|XP_004158783.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing-splicing factor 8-like [Cucumis sativus] Length = 2347 Score = 146 bits (369), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >ref|XP_004135844.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like [Cucumis sativus] Length = 2347 Score = 146 bits (369), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >ref|XP_003632761.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like isoform 1 [Vitis vinifera] Length = 2367 Score = 146 bits (369), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >ref|XP_003632762.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like isoform 2 [Vitis vinifera] gi|297743472|emb|CBI36339.3| unnamed protein product [Vitis vinifera] Length = 2347 Score = 146 bits (369), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] Length = 2294 Score = 146 bits (369), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >ref|XP_006361638.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like [Solanum tuberosum] Length = 2389 Score = 146 bits (368), Expect = 3e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 129 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 188 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 189 VVEPIYLAQ 197 >gb|EMT32957.1| Pre-mRNA-processing-splicing factor 8 [Aegilops tauschii] Length = 2409 Score = 146 bits (368), Expect = 3e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 85 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >gb|EMT11384.1| Pre-mRNA-processing-splicing factor 8 [Aegilops tauschii] Length = 2278 Score = 146 bits (368), Expect = 3e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 15 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 74 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 75 VVEPIYLAQ 83 >gb|EMS52734.1| Pre-mRNA-processing-splicing factor 8 [Triticum urartu] Length = 2339 Score = 146 bits (368), Expect = 3e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 15 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 74 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 75 VVEPIYLAQ 83 >ref|XP_004242824.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like [Solanum lycopersicum] Length = 2384 Score = 146 bits (368), Expect = 3e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVK+LYHITGAITFVNEIPW Sbjct: 124 DMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKILYHITGAITFVNEIPW 183 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 184 VVEPIYLAQ 192 >gb|ESW22754.1| hypothetical protein PHAVU_005G178600g [Phaseolus vulgaris] Length = 2358 Score = 145 bits (366), Expect = 5e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHI+GAITFVNEIPW Sbjct: 95 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHISGAITFVNEIPW 154 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 155 VVEPIYLAQ 163 >ref|XP_003546924.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like [Glycine max] Length = 2358 Score = 145 bits (366), Expect = 5e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHI+GAITFVNEIPW Sbjct: 95 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHISGAITFVNEIPW 154 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 155 VVEPIYLAQ 163 >ref|XP_004303294.1| PREDICTED: pre-mRNA-processing-splicing factor 8-like [Fragaria vesca subsp. vesca] Length = 2345 Score = 145 bits (365), Expect = 7e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKK+RHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 85 DMSSKKFRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153 >gb|EMJ16092.1| hypothetical protein PRUPE_ppa000032mg [Prunus persica] Length = 2310 Score = 145 bits (365), Expect = 7e-33 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 DMSSKKYRHDKRVYLGALKFIPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 30 DMSSKK+RHDKRVYLGALKF+PHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW Sbjct: 85 DMSSKKFRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPW 144 Query: 29 VVEPIYLAQ 3 VVEPIYLAQ Sbjct: 145 VVEPIYLAQ 153