BLASTX nr result
ID: Jatropha_contig00017604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017604 (244 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531855.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 >ref|XP_002531855.1| conserved hypothetical protein [Ricinus communis] gi|223528505|gb|EEF30533.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = +2 Query: 38 IDFPEFNRVDIFQIYQRYCEIRSRKSYKGERKEQDDDMHHCKFLKGMHLAQLLKFVELKV 217 +DF + N DIF+IY RYC+IRS K+Y +R EQ+DD+ K + LAQLLKFVEL+V Sbjct: 1 MDFSDSNWADIFEIYHRYCDIRSGKAYDTDRYEQEDDVQQGKTSRDA-LAQLLKFVELRV 59 Query: 218 HTRISIFEE 244 HTRISI +E Sbjct: 60 HTRISIVDE 68