BLASTX nr result
ID: Jatropha_contig00017428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017428 (267 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY18628.1| Chorismate synthase / 5-enolpyruvylshikimate-3-ph... 89 3e-25 gb|EOY18629.1| Chorismate synthase / 5-enolpyruvylshikimate-3-ph... 89 3e-25 ref|XP_004149912.1| PREDICTED: chorismate synthase, chloroplasti... 91 5e-25 gb|EMJ19208.1| hypothetical protein PRUPE_ppa005795mg [Prunus pe... 89 1e-24 gb|ABA54870.1| putative chorismate synthase [Fagus sylvatica] 88 5e-24 ref|NP_564534.1| putative chorismate synthase / 5-enolpyruvylshi... 84 1e-23 ref|XP_006307560.1| hypothetical protein CARUB_v10009182mg [Caps... 84 1e-23 gb|AAG50662.1|AC084242_6 chorismate synthase, putative [Arabidop... 84 1e-23 ref|XP_002894135.1| EMB1144 [Arabidopsis lyrata subsp. lyrata] g... 84 1e-23 gb|ACJ14000.1| embryo defective 1144 [Helianthus annuus] 89 4e-23 gb|ACJ13999.1| embryo defective 1144 [Helianthus annuus] gi|2119... 89 4e-23 gb|AEN69531.1| embryo defective 1144 (c4973) [Helianthus annuus]... 89 4e-23 gb|ESR49537.1| hypothetical protein CICLE_v10031547mg [Citrus cl... 86 5e-23 gb|ESQ30634.1| hypothetical protein EUTSA_v10011486mg [Eutrema s... 82 5e-23 gb|EPS63738.1| chorismate synthase 2, chloroplastic, partial [Ge... 85 6e-23 gb|AGW47887.1| chorismate synthase 1 [Nicotiana tabacum] 80 6e-23 ref|XP_003556230.1| PREDICTED: chorismate synthase, chloroplasti... 85 8e-23 sp|P27793.1|AROC_CORSE RecName: Full=Chorismate synthase, chloro... 89 1e-22 ref|XP_004307393.1| PREDICTED: chorismate synthase, chloroplasti... 87 1e-22 ref|NP_001237118.1| chorismate synthase [Glycine max] gi|7754703... 84 1e-22 >gb|EOY18628.1| Chorismate synthase / 5-enolpyruvylshikimate-3-phosphate phospholyas, putative isoform 1 [Theobroma cacao] Length = 448 Score = 89.4 bits (220), Expect(3) = 3e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEI+ MRVAFKPTATI KKQNTVTR++KEIELIARGRHDP P Sbjct: 348 IQGGISNGEIMNMRVAFKPTATIGKKQNTVTREKKEIELIARGRHDPCVVP 398 Score = 47.4 bits (111), Expect(3) = 3e-25 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 408 VALVLVDQLMAQYAQCNLFPINPELQEP 435 Score = 24.3 bits (51), Expect(3) = 3e-25 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 396 VVPRAVPMVEAM 407 >gb|EOY18629.1| Chorismate synthase / 5-enolpyruvylshikimate-3-phosphate phospholyas, putative isoform 2, partial [Theobroma cacao] Length = 375 Score = 89.4 bits (220), Expect(3) = 3e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEI+ MRVAFKPTATI KKQNTVTR++KEIELIARGRHDP P Sbjct: 275 IQGGISNGEIMNMRVAFKPTATIGKKQNTVTREKKEIELIARGRHDPCVVP 325 Score = 47.4 bits (111), Expect(3) = 3e-25 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 335 VALVLVDQLMAQYAQCNLFPINPELQEP 362 Score = 24.3 bits (51), Expect(3) = 3e-25 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 323 VVPRAVPMVEAM 334 >ref|XP_004149912.1| PREDICTED: chorismate synthase, chloroplastic-like [Cucumis sativus] gi|449505691|ref|XP_004162542.1| PREDICTED: chorismate synthase, chloroplastic-like [Cucumis sativus] Length = 439 Score = 91.3 bits (225), Expect(3) = 5e-25 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGE+I MRVAFKPTATI KKQNTVTRD+KE+ELIARGRHDP P Sbjct: 340 IQGGISNGEVISMRVAFKPTATIGKKQNTVTRDKKEVELIARGRHDPCVVP 390 Score = 44.7 bits (104), Expect(3) = 5e-25 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQLMA H QC LFPINP L P Sbjct: 400 VALVLMDQLMAQHGQCNLFPINPDLQSP 427 Score = 24.3 bits (51), Expect(3) = 5e-25 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 388 VVPRAVPMVEAM 399 >gb|EMJ19208.1| hypothetical protein PRUPE_ppa005795mg [Prunus persica] Length = 443 Score = 89.4 bits (220), Expect(3) = 1e-24 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = +1 Query: 4 QGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 QGGISNGEII MR+AFKPTATISKKQNTVTRD+ EIELIARGRHDP P Sbjct: 341 QGGISNGEIINMRIAFKPTATISKKQNTVTRDKHEIELIARGRHDPCVVP 390 Score = 47.0 bits (110), Expect(3) = 1e-24 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 +AL VDQLMAH+AQC +FPINP L EP Sbjct: 400 IALALVDQLMAHYAQCHMFPINPELQEP 427 Score = 22.3 bits (46), Expect(3) = 1e-24 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 146 VVPRAVPMGEA 178 VVPRAVPM EA Sbjct: 388 VVPRAVPMVEA 398 >gb|ABA54870.1| putative chorismate synthase [Fagus sylvatica] Length = 434 Score = 88.2 bits (217), Expect(3) = 5e-24 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGE+I MRVAFKPTATIS+KQ TVTR++KEIELIARGRHDP P Sbjct: 334 IQGGISNGEVINMRVAFKPTATISRKQQTVTREKKEIELIARGRHDPCVVP 384 Score = 44.3 bits (103), Expect(3) = 5e-24 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV DQLM+ +AQC LFPINP L EP Sbjct: 394 VALVLADQLMSQYAQCNLFPINPDLQEP 421 Score = 24.3 bits (51), Expect(3) = 5e-24 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 382 VVPRAVPMVEAM 393 >ref|NP_564534.1| putative chorismate synthase / 5-enolpyruvylshikimate-3-phosphate phospholyase [Arabidopsis thaliana] gi|83300489|sp|P57720.2|AROC_ARATH RecName: Full=Chorismate synthase, chloroplastic; AltName: Full=5-enolpyruvylshikimate-3-phosphate phospholyase; AltName: Full=Protein EMBRYO DEFECTIVE 1144; Flags: Precursor gi|15982824|gb|AAL09759.1| At1g48850/T24P22_3 [Arabidopsis thaliana] gi|53749180|gb|AAU90075.1| At1g48850 [Arabidopsis thaliana] gi|110742465|dbj|BAE99151.1| hypothetical protein [Arabidopsis thaliana] gi|332194235|gb|AEE32356.1| putative chorismate synthase / 5-enolpyruvylshikimate-3-phosphate phospholyase [Arabidopsis thaliana] Length = 436 Score = 84.3 bits (207), Expect(3) = 1e-23 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MRVAFKPT+TI +KQNTVTRD+ E E+IARGRHDP P Sbjct: 337 IQGGISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVP 387 Score = 46.6 bits (109), Expect(3) = 1e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 397 VALVLVDQLMAQYAQCHLFPINPELQEP 424 Score = 24.3 bits (51), Expect(3) = 1e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 385 VVPRAVPMVEAM 396 >ref|XP_006307560.1| hypothetical protein CARUB_v10009182mg [Capsella rubella] gi|482576271|gb|EOA40458.1| hypothetical protein CARUB_v10009182mg [Capsella rubella] Length = 435 Score = 84.3 bits (207), Expect(3) = 1e-23 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MRVAFKPT+TI +KQNTVTRD+ E E+IARGRHDP P Sbjct: 336 IQGGISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVP 386 Score = 46.6 bits (109), Expect(3) = 1e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 396 VALVLVDQLMAQYAQCHLFPINPELQEP 423 Score = 24.3 bits (51), Expect(3) = 1e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 384 VVPRAVPMVEAM 395 >gb|AAG50662.1|AC084242_6 chorismate synthase, putative [Arabidopsis thaliana] Length = 435 Score = 84.3 bits (207), Expect(3) = 1e-23 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MRVAFKPT+TI +KQNTVTRD+ E E+IARGRHDP P Sbjct: 336 IQGGISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVP 386 Score = 46.6 bits (109), Expect(3) = 1e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 396 VALVLVDQLMAQYAQCHLFPINPELQEP 423 Score = 24.3 bits (51), Expect(3) = 1e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 384 VVPRAVPMVEAM 395 >ref|XP_002894135.1| EMB1144 [Arabidopsis lyrata subsp. lyrata] gi|297339977|gb|EFH70394.1| EMB1144 [Arabidopsis lyrata subsp. lyrata] Length = 435 Score = 84.3 bits (207), Expect(3) = 1e-23 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MRVAFKPT+TI +KQNTVTRD+ E E+IARGRHDP P Sbjct: 336 IQGGISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVP 386 Score = 46.6 bits (109), Expect(3) = 1e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 396 VALVLVDQLMAQYAQCHLFPINPELQEP 423 Score = 24.3 bits (51), Expect(3) = 1e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 384 VVPRAVPMVEAM 395 >gb|ACJ14000.1| embryo defective 1144 [Helianthus annuus] Length = 109 Score = 89.0 bits (219), Expect(3) = 4e-23 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TIS+KQNTVTRD+KE ELIARGRHDP P Sbjct: 12 IQGGISNGEIINMRIAFKPTSTISRKQNTVTRDKKETELIARGRHDPCVVP 62 Score = 42.4 bits (98), Expect(3) = 4e-23 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQL+A +AQC LFPINP EP Sbjct: 72 VALVLMDQLLAQYAQCQLFPINPDFQEP 99 Score = 22.3 bits (46), Expect(3) = 4e-23 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 146 VVPRAVPMGEA 178 VVPRAVPM EA Sbjct: 60 VVPRAVPMVEA 70 >gb|ACJ13999.1| embryo defective 1144 [Helianthus annuus] gi|211953679|gb|ACJ14001.1| embryo defective 1144 [Helianthus annuus] gi|211953681|gb|ACJ14002.1| embryo defective 1144 [Helianthus annuus] gi|211953683|gb|ACJ14003.1| embryo defective 1144 [Helianthus annuus] gi|211953685|gb|ACJ14004.1| embryo defective 1144 [Helianthus annuus] gi|211953687|gb|ACJ14005.1| embryo defective 1144 [Helianthus annuus] gi|211953689|gb|ACJ14006.1| embryo defective 1144 [Helianthus annuus] gi|211953691|gb|ACJ14007.1| embryo defective 1144 [Helianthus annuus] gi|211953693|gb|ACJ14008.1| embryo defective 1144 [Helianthus annuus] gi|211953695|gb|ACJ14009.1| embryo defective 1144 [Helianthus annuus] gi|211953697|gb|ACJ14010.1| embryo defective 1144 [Helianthus annuus] gi|211953699|gb|ACJ14011.1| embryo defective 1144 [Helianthus annuus] gi|211953701|gb|ACJ14012.1| embryo defective 1144 [Helianthus annuus] gi|211953703|gb|ACJ14013.1| embryo defective 1144 [Helianthus annuus] gi|211953705|gb|ACJ14014.1| embryo defective 1144 [Helianthus annuus] gi|211953707|gb|ACJ14015.1| embryo defective 1144 [Helianthus annuus] gi|211953709|gb|ACJ14016.1| embryo defective 1144 [Helianthus annuus] gi|211953711|gb|ACJ14017.1| embryo defective 1144 [Helianthus annuus] gi|211953713|gb|ACJ14018.1| embryo defective 1144 [Helianthus annuus] gi|211953715|gb|ACJ14019.1| embryo defective 1144 [Helianthus annuus] gi|211953717|gb|ACJ14020.1| embryo defective 1144 [Helianthus annuus] gi|211953721|gb|ACJ14022.1| embryo defective 1144 [Helianthus petiolaris] Length = 109 Score = 89.0 bits (219), Expect(3) = 4e-23 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TIS+KQNTVTRD+KE ELIARGRHDP P Sbjct: 12 IQGGISNGEIINMRIAFKPTSTISRKQNTVTRDKKETELIARGRHDPCVVP 62 Score = 42.4 bits (98), Expect(3) = 4e-23 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQL+A +AQC LFPINP EP Sbjct: 72 VALVLMDQLLAQYAQCQLFPINPDFQEP 99 Score = 22.3 bits (46), Expect(3) = 4e-23 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 146 VVPRAVPMGEA 178 VVPRAVPM EA Sbjct: 60 VVPRAVPMVEA 70 >gb|AEN69531.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101329|gb|AEN69532.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101331|gb|AEN69533.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101333|gb|AEN69534.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101335|gb|AEN69535.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101337|gb|AEN69536.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101339|gb|AEN69537.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101341|gb|AEN69538.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101343|gb|AEN69539.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101345|gb|AEN69540.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101347|gb|AEN69541.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101349|gb|AEN69542.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101351|gb|AEN69543.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101353|gb|AEN69544.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101355|gb|AEN69545.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101357|gb|AEN69546.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101359|gb|AEN69547.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101361|gb|AEN69548.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101363|gb|AEN69549.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101365|gb|AEN69550.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101367|gb|AEN69551.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101369|gb|AEN69552.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101371|gb|AEN69553.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101373|gb|AEN69554.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101375|gb|AEN69555.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101377|gb|AEN69556.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101379|gb|AEN69557.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101381|gb|AEN69558.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101383|gb|AEN69559.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101385|gb|AEN69560.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101387|gb|AEN69561.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101389|gb|AEN69562.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101391|gb|AEN69563.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101393|gb|AEN69564.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101395|gb|AEN69565.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101397|gb|AEN69566.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101399|gb|AEN69567.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101401|gb|AEN69568.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101403|gb|AEN69569.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101405|gb|AEN69570.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101407|gb|AEN69571.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101409|gb|AEN69572.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101411|gb|AEN69573.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101413|gb|AEN69574.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101415|gb|AEN69575.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101417|gb|AEN69576.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101419|gb|AEN69577.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101421|gb|AEN69578.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101423|gb|AEN69579.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101425|gb|AEN69580.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101427|gb|AEN69581.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101429|gb|AEN69582.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101431|gb|AEN69583.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101433|gb|AEN69584.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101435|gb|AEN69585.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101437|gb|AEN69586.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101439|gb|AEN69587.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101441|gb|AEN69588.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101443|gb|AEN69589.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101445|gb|AEN69590.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101447|gb|AEN69591.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101449|gb|AEN69592.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101451|gb|AEN69593.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101453|gb|AEN69594.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101455|gb|AEN69595.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101457|gb|AEN69596.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101459|gb|AEN69597.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101461|gb|AEN69598.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101463|gb|AEN69599.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101465|gb|AEN69600.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101467|gb|AEN69601.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101469|gb|AEN69602.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101471|gb|AEN69603.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101473|gb|AEN69604.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101475|gb|AEN69605.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101477|gb|AEN69606.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101479|gb|AEN69607.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101481|gb|AEN69608.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101483|gb|AEN69609.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101485|gb|AEN69610.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101487|gb|AEN69611.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101489|gb|AEN69612.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101491|gb|AEN69613.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101493|gb|AEN69614.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101495|gb|AEN69615.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101497|gb|AEN69616.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101499|gb|AEN69617.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101501|gb|AEN69618.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101503|gb|AEN69619.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101505|gb|AEN69620.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101507|gb|AEN69621.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101509|gb|AEN69622.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101511|gb|AEN69623.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101513|gb|AEN69624.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101515|gb|AEN69625.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101517|gb|AEN69626.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101519|gb|AEN69627.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101521|gb|AEN69628.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101523|gb|AEN69629.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101525|gb|AEN69630.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101527|gb|AEN69631.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101529|gb|AEN69632.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101531|gb|AEN69633.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101533|gb|AEN69634.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101535|gb|AEN69635.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101537|gb|AEN69636.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101539|gb|AEN69637.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101541|gb|AEN69638.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101543|gb|AEN69639.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101545|gb|AEN69640.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101547|gb|AEN69641.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101549|gb|AEN69642.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101551|gb|AEN69643.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101553|gb|AEN69644.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101555|gb|AEN69645.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101557|gb|AEN69646.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101559|gb|AEN69647.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101561|gb|AEN69648.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101563|gb|AEN69649.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101565|gb|AEN69650.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101567|gb|AEN69651.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101569|gb|AEN69652.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101571|gb|AEN69653.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101573|gb|AEN69654.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101575|gb|AEN69655.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101577|gb|AEN69656.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101579|gb|AEN69657.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101581|gb|AEN69658.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101583|gb|AEN69659.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101585|gb|AEN69660.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101587|gb|AEN69661.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101589|gb|AEN69662.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101591|gb|AEN69663.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101593|gb|AEN69664.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101595|gb|AEN69665.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101597|gb|AEN69666.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101601|gb|AEN69668.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101603|gb|AEN69669.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101605|gb|AEN69670.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101607|gb|AEN69671.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101609|gb|AEN69672.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101611|gb|AEN69673.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101613|gb|AEN69674.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101615|gb|AEN69675.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101617|gb|AEN69676.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101619|gb|AEN69677.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101621|gb|AEN69678.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101623|gb|AEN69679.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101625|gb|AEN69680.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101627|gb|AEN69681.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101629|gb|AEN69682.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101631|gb|AEN69683.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101633|gb|AEN69684.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101635|gb|AEN69685.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101637|gb|AEN69686.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101639|gb|AEN69687.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101641|gb|AEN69688.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101643|gb|AEN69689.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101645|gb|AEN69690.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101647|gb|AEN69691.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101649|gb|AEN69692.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101651|gb|AEN69693.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101653|gb|AEN69694.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101655|gb|AEN69695.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101657|gb|AEN69696.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101659|gb|AEN69697.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101661|gb|AEN69698.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101663|gb|AEN69699.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101665|gb|AEN69700.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101667|gb|AEN69701.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101669|gb|AEN69702.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101671|gb|AEN69703.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101673|gb|AEN69704.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101675|gb|AEN69705.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101677|gb|AEN69706.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101679|gb|AEN69707.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101681|gb|AEN69708.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101683|gb|AEN69709.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101685|gb|AEN69710.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101687|gb|AEN69711.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101689|gb|AEN69712.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101691|gb|AEN69713.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101693|gb|AEN69714.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101695|gb|AEN69715.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101697|gb|AEN69716.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101699|gb|AEN69717.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101701|gb|AEN69718.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101703|gb|AEN69719.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101705|gb|AEN69720.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101707|gb|AEN69721.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101709|gb|AEN69722.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101711|gb|AEN69723.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101713|gb|AEN69724.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101715|gb|AEN69725.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101717|gb|AEN69726.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101719|gb|AEN69727.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101721|gb|AEN69728.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101723|gb|AEN69729.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101725|gb|AEN69730.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101727|gb|AEN69731.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101729|gb|AEN69732.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101731|gb|AEN69733.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101733|gb|AEN69734.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101735|gb|AEN69735.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101737|gb|AEN69736.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101739|gb|AEN69737.1| embryo defective 1144 (c4973) [Helianthus annuus] gi|345101741|gb|AEN69738.1| embryo defective 1144 (c4973) [Helianthus annuus] Length = 95 Score = 89.0 bits (219), Expect(3) = 4e-23 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TIS+KQNTVTRD+KE ELIARGRHDP P Sbjct: 5 IQGGISNGEIINMRIAFKPTSTISRKQNTVTRDKKETELIARGRHDPCVVP 55 Score = 42.4 bits (98), Expect(3) = 4e-23 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQL+A +AQC LFPINP EP Sbjct: 65 VALVLMDQLLAQYAQCQLFPINPDFQEP 92 Score = 22.3 bits (46), Expect(3) = 4e-23 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 146 VVPRAVPMGEA 178 VVPRAVPM EA Sbjct: 53 VVPRAVPMVEA 63 >gb|ESR49537.1| hypothetical protein CICLE_v10031547mg [Citrus clementina] Length = 442 Score = 85.9 bits (211), Expect(3) = 5e-23 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TI +KQNTVTR++KE ELIARGRHDP P Sbjct: 340 IQGGISNGEIINMRIAFKPTSTIGRKQNTVTREKKETELIARGRHDPCVVP 390 Score = 43.1 bits (100), Expect(3) = 5e-23 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPML 257 VALV +DQLMA HAQC LFPINP L Sbjct: 400 VALVLMDQLMAQHAQCHLFPINPDL 424 Score = 24.3 bits (51), Expect(3) = 5e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 388 VVPRAVPMVEAM 399 >gb|ESQ30634.1| hypothetical protein EUTSA_v10011486mg [Eutrema salsugineum] Length = 441 Score = 82.4 bits (202), Expect(3) = 5e-23 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MRVAFKPT+TI +KQ TVTRD++E E+IARGRHDP P Sbjct: 336 IQGGISNGEIINMRVAFKPTSTIGRKQMTVTRDKQETEMIARGRHDPCVVP 386 Score = 46.6 bits (109), Expect(3) = 5e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFPINP L EP Sbjct: 396 VALVLVDQLMAQYAQCHLFPINPELQEP 423 Score = 24.3 bits (51), Expect(3) = 5e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 384 VVPRAVPMVEAM 395 >gb|EPS63738.1| chorismate synthase 2, chloroplastic, partial [Genlisea aurea] Length = 453 Score = 85.1 bits (209), Expect(3) = 6e-23 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGE+I MR+AFKPT+TI++KQNTVTRD+ E ELIARGRHDP P Sbjct: 354 IQGGISNGEVINMRIAFKPTSTIARKQNTVTRDKHETELIARGRHDPCVVP 404 Score = 43.5 bits (101), Expect(3) = 6e-23 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 186 ALVFVDQLMAHHAQCGLFPINPMLPEP 266 ALV VDQLMA AQC +FPINP L EP Sbjct: 415 ALVLVDQLMAQQAQCMMFPINPALQEP 441 Score = 24.3 bits (51), Expect(3) = 6e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 402 VVPRAVPMVEAM 413 >gb|AGW47887.1| chorismate synthase 1 [Nicotiana tabacum] Length = 441 Score = 80.5 bits (197), Expect(3) = 6e-23 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGE+I M++AFKPT+TI++KQ TVTRD+ + ELIARGRHDP P Sbjct: 341 IQGGISNGEVINMKIAFKPTSTIARKQQTVTRDKHDTELIARGRHDPCVVP 391 Score = 48.1 bits (113), Expect(3) = 6e-23 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VAL VDQLMAH+AQC LFPINP L EP Sbjct: 401 VALALVDQLMAHYAQCMLFPINPALQEP 428 Score = 24.3 bits (51), Expect(3) = 6e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 389 VVPRAVPMVEAM 400 >ref|XP_003556230.1| PREDICTED: chorismate synthase, chloroplastic-like [Glycine max] Length = 435 Score = 84.7 bits (208), Expect(3) = 8e-23 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TI KKQ TVTRD+KE E IARGRHDP P Sbjct: 336 IQGGISNGEIINMRIAFKPTSTIGKKQKTVTRDKKETEFIARGRHDPCVVP 386 Score = 43.5 bits (101), Expect(3) = 8e-23 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFP+N L EP Sbjct: 396 VALVLVDQLMAQYAQCNLFPVNSDLQEP 423 Score = 24.3 bits (51), Expect(3) = 8e-23 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 384 VVPRAVPMVEAM 395 >sp|P27793.1|AROC_CORSE RecName: Full=Chorismate synthase, chloroplastic; AltName: Full=5-enolpyruvylshikimate-3-phosphate phospholyase; Flags: Precursor gi|18256|emb|CAA43034.1| chorismate synthase [Capnoides sempervirens] Length = 447 Score = 88.6 bits (218), Expect(3) = 1e-22 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TI KKQNTVTR+R+EIELIARGRHDP P Sbjct: 345 IQGGISNGEIINMRIAFKPTSTIGKKQNTVTREREEIELIARGRHDPCVVP 395 Score = 39.3 bits (90), Expect(3) = 1e-22 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQLM HAQ LF INP L EP Sbjct: 405 VALVLLDQLMLQHAQGNLFSINPALQEP 432 Score = 24.3 bits (51), Expect(3) = 1e-22 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 393 VVPRAVPMVEAM 404 >ref|XP_004307393.1| PREDICTED: chorismate synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 439 Score = 87.4 bits (215), Expect(3) = 1e-22 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 4 QGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 QGGISNGEII MR+AFKPTATI++KQNTVTRD+KE ELIARGRHDP P Sbjct: 340 QGGISNGEIINMRIAFKPTATIARKQNTVTRDKKETELIARGRHDPCVVP 389 Score = 42.4 bits (98), Expect(3) = 1e-22 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV +DQLMA +AQC LFP NP + EP Sbjct: 399 VALVLMDQLMAQYAQCHLFPFNPDVQEP 426 Score = 22.3 bits (46), Expect(3) = 1e-22 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 146 VVPRAVPMGEA 178 VVPRAVPM EA Sbjct: 387 VVPRAVPMVEA 397 >ref|NP_001237118.1| chorismate synthase [Glycine max] gi|77547031|gb|ABA90483.1| chorismate synthase [Glycine max] Length = 436 Score = 84.0 bits (206), Expect(3) = 1e-22 Identities = 40/51 (78%), Positives = 42/51 (82%) Frame = +1 Query: 1 IQGGISNGEIIKMRVAFKPTATISKKQNTVTRDRKEIELIARGRHDPWCCP 153 IQGGISNGEII MR+AFKPT+TI KK NTVTRD KE E IARGRHDP P Sbjct: 337 IQGGISNGEIINMRIAFKPTSTIGKKHNTVTRDTKETEFIARGRHDPCVVP 387 Score = 43.5 bits (101), Expect(3) = 1e-22 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +3 Query: 183 VALVFVDQLMAHHAQCGLFPINPMLPEP 266 VALV VDQLMA +AQC LFP+N L EP Sbjct: 397 VALVLVDQLMAQYAQCNLFPVNSDLQEP 424 Score = 24.3 bits (51), Expect(3) = 1e-22 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 146 VVPRAVPMGEAM 181 VVPRAVPM EAM Sbjct: 385 VVPRAVPMVEAM 396