BLASTX nr result
ID: Jatropha_contig00017411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017411 (753 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514455.1| conserved hypothetical protein [Ricinus comm... 58 4e-06 ref|XP_002533865.1| conserved hypothetical protein [Ricinus comm... 44 6e-06 >ref|XP_002514455.1| conserved hypothetical protein [Ricinus communis] gi|223546451|gb|EEF47951.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 57.8 bits (138), Expect = 4e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -3 Query: 670 LMERWNDCTHTFLFGFGEMTLTPVDYAAITGLQFAGPVVPLD 545 L+ERW+D THTF+ F EMT+TP+ + A+TG +F G VPLD Sbjct: 28 LLERWSDTTHTFVLHFREMTITPMHFTALTGTRFGGVSVPLD 69 >ref|XP_002533865.1| conserved hypothetical protein [Ricinus communis] gi|223526187|gb|EEF28515.1| conserved hypothetical protein [Ricinus communis] Length = 918 Score = 43.5 bits (101), Expect(2) = 6e-06 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = -3 Query: 670 LMERWNDCTHTFLFGFGEMTLTPVDYAAITGLQFAG-PVVPLDAWY*TATLGAQLVRSLL 494 L+ERW T+TF FG GEMT+T D A + GL G PV+ + T T + + LL Sbjct: 79 LVERWRRETNTFHFGVGEMTVTLQDVALLLGLAIDGRPVIGI-----THTTCSLVCERLL 133 Query: 493 GVTTQTRYTA*GCV 452 G + Y + G V Sbjct: 134 GKAPDSSYASGGMV 147 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 335 DQAARSFLFYIISSQLLCTS*NKGDPAVLVCL-RDLGQVGSFDWATLALAHLYHGL 171 ++ R++L Y++ S + T+ P + + L + + G+F W ALA LY L Sbjct: 169 ERCTRAYLLYLVGSTIFSTTTGNKVPVMYLPLFENFEEAGNFAWGAAALAFLYRAL 224