BLASTX nr result
ID: Jatropha_contig00017281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017281 (489 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 67 2e-09 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 479 FVIERIHYSGLVKGPPPSGCCSYFTAL*PRPVPHAEDLDHTPVC 348 FVIERIHYSGLV+G P SG CSY AL P V +AEDLDHTPVC Sbjct: 231 FVIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTPVC 274