BLASTX nr result
ID: Jatropha_contig00017208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017208 (438 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531815.1| auxin:hydrogen symporter, putative [Ricinus ... 57 2e-06 >ref|XP_002531815.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223528549|gb|EEF30572.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 416 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 329 MSHTMERFLSAVASSMENQVAGQSVIGTIKIAVLPV 436 M+HTMERFLSAV S M+NQVAGQS+IGTI+IAVLP+ Sbjct: 1 MAHTMERFLSAVVS-MDNQVAGQSLIGTIRIAVLPI 35