BLASTX nr result
ID: Jatropha_contig00017133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017133 (191 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530772.1| ATP binding protein, putative [Ricinus commu... 68 1e-09 ref|XP_004165644.1| PREDICTED: calmodulin-binding receptor-like ... 56 4e-06 ref|XP_004150526.1| PREDICTED: calmodulin-binding receptor-like ... 56 4e-06 >ref|XP_002530772.1| ATP binding protein, putative [Ricinus communis] gi|223529688|gb|EEF31632.1| ATP binding protein, putative [Ricinus communis] Length = 386 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 74 TFSTSKQVGIIATGIVAMSCGLLCPCFYRKRKATS 178 +FST KQVGI+ATGIV +SCGLLCPCFYRKRKATS Sbjct: 2 SFSTPKQVGIVATGIVVISCGLLCPCFYRKRKATS 36 >ref|XP_004165644.1| PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 3-like [Cucumis sativus] Length = 522 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +2 Query: 32 GEDIPQKKKNNDSTTFSTSKQVGIIATGIVAMSCGLLCPCFYRKRK 169 G+ +PQ+ K D +FST K +GI TG + CG+LCPCFYRKR+ Sbjct: 120 GQYLPQRAKE-DPKSFSTPKNIGIAVTGTFVLCCGVLCPCFYRKRR 164 >ref|XP_004150526.1| PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 3-like [Cucumis sativus] Length = 522 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +2 Query: 32 GEDIPQKKKNNDSTTFSTSKQVGIIATGIVAMSCGLLCPCFYRKRK 169 G+ +PQ+ K D +FST K +GI TG + CG+LCPCFYRKR+ Sbjct: 120 GQYLPQRAKE-DPKSFSTPKNIGIAVTGTFVLCCGVLCPCFYRKRR 164