BLASTX nr result
ID: Jatropha_contig00017044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00017044 (450 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531334.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 >ref|XP_002531334.1| conserved hypothetical protein [Ricinus communis] gi|223529056|gb|EEF31041.1| conserved hypothetical protein [Ricinus communis] Length = 234 Score = 58.5 bits (140), Expect = 8e-07 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (4%) Frame = +2 Query: 227 MDMISGRPVDSG---VLVDEIESKFSNFVRVEDVQETFVSDGDEYSDAKEGCEELEPYGP 397 MD+ S R VD+G V VDEIES F FV V+D +E+ SDGD+ SD +EG EELEP+ P Sbjct: 1 MDISSAR-VDAGGGGVRVDEIESSFRKFVHVDDTRESSPSDGDDNSD-EEGSEELEPFRP 58 Query: 398 E 400 E Sbjct: 59 E 59