BLASTX nr result
ID: Jatropha_contig00016932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016932 (133 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518581.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 >ref|XP_002518581.1| conserved hypothetical protein [Ricinus communis] gi|223542426|gb|EEF43968.1| conserved hypothetical protein [Ricinus communis] Length = 591 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 133 SGTVSDGVHMGPSMQNVGGNIGHSVGASHPNVWAARKKMASGV 5 SG VS+G H+G S QNVGGN G S G SHPN+WAARK++A GV Sbjct: 148 SGRVSEGSHVGASSQNVGGNNGQSAG-SHPNIWAARKELAVGV 189