BLASTX nr result
ID: Jatropha_contig00016874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016874 (529 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing r... 51 7e-08 ref|XP_003592149.1| Cysteine-rich receptor-like protein kinase [... 46 9e-06 >ref|XP_004496496.1| PREDICTED: L-type lectin-domain containing receptor kinase S.6-like [Cicer arietinum] Length = 679 Score = 51.2 bits (121), Expect(2) = 7e-08 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -3 Query: 527 DAVRIFKGEAPLPSLPASKPRVRIRLVLPNDTEKIMECCWRW 402 DA R+ K EAPLP LP SKPRVRIR V PNDT + W Sbjct: 622 DAARMIKKEAPLPLLPQSKPRVRIRPVCPNDTPETQNVVGDW 663 Score = 30.8 bits (68), Expect(2) = 7e-08 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 418 NVVGDGPNMDDAPYLTHRIQF 356 NVVGD + D+APYLT R QF Sbjct: 658 NVVGDWLSADEAPYLTPRSQF 678 >ref|XP_003592149.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355481197|gb|AES62400.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 666 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = -3 Query: 527 DAVRIFKGEAPLPSLPASKPRVRIRLVLPNDTEKIMECCWRW 402 DA R+ K EAPLP LP +KP VRI V PNDT + + W Sbjct: 609 DAARMIKKEAPLPLLPTTKPWVRIMPVCPNDTPETQDVVGDW 650 Score = 28.9 bits (63), Expect(2) = 9e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 418 NVVGDGPNMDDAPYLTHRIQF 356 +VVGD + D+APYLT R QF Sbjct: 645 DVVGDWVSNDEAPYLTPRSQF 665