BLASTX nr result
ID: Jatropha_contig00016628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016628 (278 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_016971917.1| hypothetical protein [Pseudomonas tolaasii] 61 1e-07 >ref|WP_016971917.1| hypothetical protein [Pseudomonas tolaasii] Length = 116 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 143 DVLVSTPLG*EVVVNKSYQDCPLMIQDHIFLSDLTEMPFRDFDVI 277 D+LV+ PLG VVVNK Y+ CPL IQ + FL+DL E+PF +FDVI Sbjct: 21 DILVTNPLGHSVVVNKVYKGCPLRIQGYEFLADLIELPFHEFDVI 65