BLASTX nr result
ID: Jatropha_contig00016512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016512 (628 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer ar... 57 3e-06 >ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 1951 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = +3 Query: 42 TVTNNPIVQTSSLQLPPTCKQYLTDKIDNLVEISHIPESAQIQNSLVPILNPYVIRNRYH 221 T + PI TSS+ LP TCK+ + KI+NL+E +++P+ QI ++ P+L+PY I R Sbjct: 4 TESKQPITITSSISLPKTCKKTESHKIENLIEYTYVPDDVQIAETVPPLLSPYNIFKRQR 63 Query: 222 S 224 S Sbjct: 64 S 64