BLASTX nr result
ID: Jatropha_contig00016475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016475 (468 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518219.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >ref|XP_002518219.1| conserved hypothetical protein [Ricinus communis] gi|223542624|gb|EEF44162.1| conserved hypothetical protein [Ricinus communis] Length = 544 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 370 VAVPQSRTAVAVTALAGIAVCAALFYTTSRGHL 468 VA PQSRTAVAVTALAGIAV AA+FYTTSRGHL Sbjct: 27 VAAPQSRTAVAVTALAGIAVFAAIFYTTSRGHL 59