BLASTX nr result
ID: Jatropha_contig00016400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016400 (132 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527789.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 gb|EOY01036.1| ARM repeat superfamily protein, putative isoform ... 55 7e-06 gb|EOY01035.1| ARM repeat superfamily protein isoform 2 [Theobro... 55 7e-06 gb|EOY01034.1| ARM repeat superfamily protein isoform 1 [Theobro... 55 7e-06 >ref|XP_002527789.1| conserved hypothetical protein [Ricinus communis] gi|223532824|gb|EEF34599.1| conserved hypothetical protein [Ricinus communis] Length = 765 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +3 Query: 15 RKDVLDSSVISRLVEMLKHSSSNLQRKAAAILEYVAMID 131 R+D+LDSSVI+RLVE+LKHSSSNLQRK A ++E++A+ D Sbjct: 490 RQDLLDSSVIARLVEILKHSSSNLQRKVATVIEFLALND 528 >gb|EOY01036.1| ARM repeat superfamily protein, putative isoform 3 [Theobroma cacao] Length = 645 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/39 (66%), Positives = 37/39 (94%) Frame = +3 Query: 15 RKDVLDSSVISRLVEMLKHSSSNLQRKAAAILEYVAMID 131 RK++LDS+VI+RL+E+LK SSSNLQRKAA+ILE++ +I+ Sbjct: 370 RKELLDSAVITRLIEILKASSSNLQRKAASILEFMTIIE 408 >gb|EOY01035.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 699 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/39 (66%), Positives = 37/39 (94%) Frame = +3 Query: 15 RKDVLDSSVISRLVEMLKHSSSNLQRKAAAILEYVAMID 131 RK++LDS+VI+RL+E+LK SSSNLQRKAA+ILE++ +I+ Sbjct: 583 RKELLDSAVITRLIEILKASSSNLQRKAASILEFMTIIE 621 >gb|EOY01034.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 858 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/39 (66%), Positives = 37/39 (94%) Frame = +3 Query: 15 RKDVLDSSVISRLVEMLKHSSSNLQRKAAAILEYVAMID 131 RK++LDS+VI+RL+E+LK SSSNLQRKAA+ILE++ +I+ Sbjct: 583 RKELLDSAVITRLIEILKASSSNLQRKAASILEFMTIIE 621