BLASTX nr result
ID: Jatropha_contig00016277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00016277 (610 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535797.1| conserved hypothetical protein [Ricinus comm... 69 7e-10 ref|XP_002535796.1| conserved hypothetical protein [Ricinus comm... 50 9e-09 >ref|XP_002535797.1| conserved hypothetical protein [Ricinus communis] gi|223521923|gb|EEF26586.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 69.3 bits (168), Expect = 7e-10 Identities = 39/63 (61%), Positives = 39/63 (61%) Frame = +1 Query: 421 MLLVSRYVPVLQQYWRKRIGPSLADRSRVEXXXXXXXXXXXXXXXXXXXXFGGSFVLRSL 600 MLLVSR VPV QQYWRKRIGPSLADRSRVE FGGSFVL SL Sbjct: 1 MLLVSRQVPVSQQYWRKRIGPSLADRSRVELALLPRLSLTRLSRTQSLFLFGGSFVLHSL 60 Query: 601 ALA 609 A A Sbjct: 61 APA 63 >ref|XP_002535796.1| conserved hypothetical protein [Ricinus communis] gi|223521922|gb|EEF26585.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 49.7 bits (117), Expect(2) = 9e-09 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +2 Query: 332 SMFLWRNHIRNKIENAFKKER*SDGQP 412 S+FLWRNH R KIE AFKKER SDGQP Sbjct: 36 SVFLWRNHTRKKIEKAFKKERESDGQP 62 Score = 36.2 bits (82), Expect(2) = 9e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +3 Query: 258 VLDETI*IPHYAVGWGES 311 VLDETI IPHYAVGWG + Sbjct: 2 VLDETIQIPHYAVGWGSA 19