BLASTX nr result
ID: Jatropha_contig00015847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00015847 (745 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 76 2e-14 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 75.9 bits (185), Expect(2) = 2e-14 Identities = 45/83 (54%), Positives = 48/83 (57%), Gaps = 2/83 (2%) Frame = -1 Query: 691 RSVDRAALSFEDWTVSPIILQXXXXXXXXXXXXXXXXXXI--ERIHYSGLVERPSSSGCY 518 RS+DRAAL FEDWTVSPIILQ ERIHYSGLVE SG Sbjct: 192 RSLDRAALGFEDWTVSPIILQVLLLSSFPYFFFCVLIHSFVIERIHYSGLVEGSPLSGRC 251 Query: 517 SYFIAL*PRSVPHAKDFDHIPVC 449 SY AL P SV +A+D DH PVC Sbjct: 252 SYPFALQPFSVSYAEDLDHTPVC 274 Score = 30.0 bits (66), Expect(2) = 2e-14 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 743 QMRDMGCMAGIVLAETIK 690 QM DM C+ GIVL+ETI+ Sbjct: 175 QMEDMSCIGGIVLSETIR 192