BLASTX nr result
ID: Jatropha_contig00015775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00015775 (397 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528129.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 >ref|XP_002528129.1| conserved hypothetical protein [Ricinus communis] gi|223532468|gb|EEF34259.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/70 (54%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +1 Query: 88 MDSGLFNGAAYCNNN---GEVEMVDLTLKLGLPYEAKNPSHLRQHVNHVPTTPDLANFNL 258 MDSG ++ N N G E VDLTLKLGLP E N SHLRQ V+ PTT DL+N N Sbjct: 1 MDSGAGRSISFYNVNDDSGNYE-VDLTLKLGLPNEDNNQSHLRQQVDRNPTTSDLSNLNF 59 Query: 259 GGPYTASQAA 288 GPY+ + AA Sbjct: 60 SGPYSTTAAA 69