BLASTX nr result
ID: Jatropha_contig00015370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00015370 (536 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67195.1| hypothetical protein [Jatropha curcas] 84 1e-14 >gb|ADJ67195.1| hypothetical protein [Jatropha curcas] Length = 59 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -1 Query: 128 KTPQVEKNHGHCQTTTKKNIHYVANCYNHNYKIFFYPTPSKN 3 KTPQVEKNH CQTT KKNIHY ANCYNHNYKIFFY TPSK+ Sbjct: 3 KTPQVEKNHDRCQTTIKKNIHYAANCYNHNYKIFFYLTPSKH 44