BLASTX nr result
ID: Jatropha_contig00015191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00015191 (662 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517537.1| Katanin p60 ATPase-containing subunit, putat... 107 4e-21 gb|EOY26649.1| P-loop containing nucleoside triphosphate hydrola... 105 9e-21 gb|EOY26648.1| P-loop containing nucleoside triphosphate hydrola... 105 9e-21 gb|ESR40360.1| hypothetical protein CICLE_v10025365mg [Citrus cl... 105 1e-20 gb|AGG55715.1| katanin1 [Gossypium arboreum] 105 1e-20 gb|AGG55714.1| katanin1 [Gossypium arboreum] 105 1e-20 gb|AAP83637.1| katanin [Gossypium hirsutum] 105 1e-20 gb|EMJ16227.1| hypothetical protein PRUPE_ppa004240mg [Prunus pe... 104 3e-20 gb|AAP43505.2| katanin-like protein [Gossypium hirsutum] 103 3e-20 gb|EEE84426.2| ECTOPIC ROOT HAIR 3 family protein [Populus trich... 103 6e-20 gb|ERP63279.1| hypothetical protein POPTR_0003s05650g [Populus t... 103 6e-20 gb|EEE78253.2| hypothetical protein POPTR_0003s05650g [Populus t... 103 6e-20 gb|ERP63278.1| hypothetical protein POPTR_0003s05650g [Populus t... 103 6e-20 ref|XP_003546244.1| PREDICTED: katanin p60 ATPase-containing sub... 103 6e-20 ref|XP_002284961.1| PREDICTED: katanin p60 ATPase-containing sub... 103 6e-20 ref|XP_002299621.1| predicted protein [Populus trichocarpa] 103 6e-20 ref|XP_002303274.1| predicted protein [Populus trichocarpa] 103 6e-20 gb|ABK96572.1| unknown [Populus trichocarpa x Populus deltoides] 103 6e-20 ref|XP_004302933.1| PREDICTED: katanin p60 ATPase-containing sub... 102 7e-20 gb|ESW07708.1| hypothetical protein PHAVU_010G152000g [Phaseolus... 102 1e-19 >ref|XP_002517537.1| Katanin p60 ATPase-containing subunit, putative [Ricinus communis] gi|223543169|gb|EEF44701.1| Katanin p60 ATPase-containing subunit, putative [Ricinus communis] Length = 523 Score = 107 bits (266), Expect = 4e-21 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 349 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 401 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 316 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 348 >gb|EOY26649.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 465 Score = 105 bits (263), Expect = 9e-21 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT+TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 292 ASGEHESSRRVKSELLVQVDGVNNTATNEDGSRKIVMVLAATNFPWDIDEALR 344 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 259 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 291 >gb|EOY26648.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 589 Score = 105 bits (263), Expect = 9e-21 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT+TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 398 ASGEHESSRRVKSELLVQVDGVNNTATNEDGSRKIVMVLAATNFPWDIDEALR 450 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 365 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 397 >gb|ESR40360.1| hypothetical protein CICLE_v10025365mg [Citrus clementina] Length = 522 Score = 105 bits (262), Expect = 1e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 348 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGSRKIVMVLAATNFPWDIDEALR 400 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 315 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 347 >gb|AGG55715.1| katanin1 [Gossypium arboreum] Length = 520 Score = 105 bits (262), Expect = 1e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 346 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGSRKIVMVLAATNFPWDIDEALR 398 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 313 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 345 >gb|AGG55714.1| katanin1 [Gossypium arboreum] Length = 520 Score = 105 bits (262), Expect = 1e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 346 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGSRKIVMVLAATNFPWDIDEALR 398 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 313 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 345 >gb|AAP83637.1| katanin [Gossypium hirsutum] Length = 520 Score = 105 bits (262), Expect = 1e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 346 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGSRKIVMVLAATNFPWDIDEALR 398 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 313 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 345 >gb|EMJ16227.1| hypothetical protein PRUPE_ppa004240mg [Prunus persica] Length = 521 Score = 104 bits (259), Expect = 3e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDG+RKIVMVLAATNFPWDIDEALR Sbjct: 347 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGTRKIVMVLAATNFPWDIDEALR 399 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCN+RG Sbjct: 314 SERMVRCLFDLARAYAPSTIFIDEIDSLCNSRG 346 >gb|AAP43505.2| katanin-like protein [Gossypium hirsutum] Length = 520 Score = 103 bits (258), Expect = 3e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNNT TNEDGSRKIV+VLAATNFPWDIDEALR Sbjct: 346 ASGEHESSRRVKSELLVQVDGVNNTGTNEDGSRKIVVVLAATNFPWDIDEALR 398 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 S+RMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 313 SKRMVRCLFDLARAYAPSTIFIDEIDSLCNARG 345 >gb|EEE84426.2| ECTOPIC ROOT HAIR 3 family protein [Populus trichocarpa] Length = 531 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 357 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 409 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 324 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 356 >gb|ERP63279.1| hypothetical protein POPTR_0003s05650g [Populus trichocarpa] Length = 436 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 353 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 405 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 320 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 352 >gb|EEE78253.2| hypothetical protein POPTR_0003s05650g [Populus trichocarpa] Length = 527 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 353 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 405 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 320 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 352 >gb|ERP63278.1| hypothetical protein POPTR_0003s05650g [Populus trichocarpa] Length = 465 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 291 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 343 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 258 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 290 >ref|XP_003546244.1| PREDICTED: katanin p60 ATPase-containing subunit-like [Glycine max] Length = 478 Score = 103 bits (256), Expect = 6e-20 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQ+DGVNN+STNEDG+RKIVMVLAATNFPWDIDEALR Sbjct: 304 ASGEHESSRRVKSELLVQLDGVNNSSTNEDGTRKIVMVLAATNFPWDIDEALR 356 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 271 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 303 >ref|XP_002284961.1| PREDICTED: katanin p60 ATPase-containing subunit [Vitis vinifera] gi|297743333|emb|CBI36200.3| unnamed protein product [Vitis vinifera] Length = 521 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 347 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 399 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 314 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 346 >ref|XP_002299621.1| predicted protein [Populus trichocarpa] Length = 526 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 352 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 404 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 319 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 351 >ref|XP_002303274.1| predicted protein [Populus trichocarpa] Length = 498 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 353 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 405 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 320 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 352 >gb|ABK96572.1| unknown [Populus trichocarpa x Populus deltoides] Length = 525 Score = 103 bits (256), Expect = 6e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVNN+ST EDGSRKIVMVLAATNFPWDIDEALR Sbjct: 351 ASGEHESSRRVKSELLVQVDGVNNSSTGEDGSRKIVMVLAATNFPWDIDEALR 403 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 318 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 350 >ref|XP_004302933.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Fragaria vesca subsp. vesca] Length = 532 Score = 102 bits (255), Expect = 7e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGVN TSTNEDG+RKIVMVLAATNFPWDIDEALR Sbjct: 358 ASGEHESSRRVKSELLVQVDGVNATSTNEDGTRKIVMVLAATNFPWDIDEALR 410 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCN+RG Sbjct: 325 SERMVRCLFDLARAYAPSTIFIDEIDSLCNSRG 357 >gb|ESW07708.1| hypothetical protein PHAVU_010G152000g [Phaseolus vulgaris] Length = 530 Score = 102 bits (254), Expect = 1e-19 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +3 Query: 456 ASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALR 614 ASGEHESSRRVKSELLVQVDGV+N++TNEDGSRKIVMVLAATNFPWDIDEALR Sbjct: 356 ASGEHESSRRVKSELLVQVDGVSNSATNEDGSRKIVMVLAATNFPWDIDEALR 408 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 100 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG Sbjct: 323 SERMVRCLFDLARAYAPSTIFIDEIDSLCNARG 355