BLASTX nr result
ID: Jatropha_contig00014761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014761 (437 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 62 6e-08 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 423 PHFFF--LFKSFLVIERIHYLGLVEGSPSSGYCSYFLSL*PISVSHAEDLN 277 P+FFF L SF VIERIHY GLVEGSP SG CSY +L P SVS+AEDL+ Sbjct: 220 PYFFFCVLIHSF-VIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLD 269