BLASTX nr result
ID: Jatropha_contig00014597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014597 (510 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 64 3e-08 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -2 Query: 506 HSLVIERIHYSGLVEGSPSSGYCSYFPSL*PISVSHAEDLNLAP 375 HS VIERIHYSGLVEGSP SG CSY +L P SVS+AEDL+ P Sbjct: 229 HSFVIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTP 272