BLASTX nr result
ID: Jatropha_contig00014462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014462 (614 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527312.1| pentatricopeptide repeat-containing protein,... 59 1e-06 gb|ESR34482.1| hypothetical protein CICLE_v10004328mg [Citrus cl... 57 3e-06 gb|ESR34481.1| hypothetical protein CICLE_v10004328mg [Citrus cl... 57 3e-06 gb|ESR34480.1| hypothetical protein CICLE_v10004328mg [Citrus cl... 57 3e-06 gb|ESR34479.1| hypothetical protein CICLE_v10004328mg [Citrus cl... 57 3e-06 >ref|XP_002527312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533312|gb|EEF35064.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 802 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 502 FAMETVRIMREKGIGLNNRSCLFMMQALCKGGYMEE 395 FAMET RIM EK IG NN SCL M++ALCKGGY+EE Sbjct: 110 FAMETWRIMEEKEIGFNNISCLLMVRALCKGGYLEE 145 >gb|ESR34482.1| hypothetical protein CICLE_v10004328mg [Citrus clementina] gi|557523116|gb|ESR34483.1| hypothetical protein CICLE_v10004328mg [Citrus clementina] Length = 823 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 502 FAMETVRIMREKGIGLNNRSCLFMMQALCKGGYMEEVNAYCFTLCKNF 359 F MET R+M EK IGLNN+ L MMQALCKGGY+EE + + L + + Sbjct: 110 FVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERY 157 >gb|ESR34481.1| hypothetical protein CICLE_v10004328mg [Citrus clementina] Length = 782 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 502 FAMETVRIMREKGIGLNNRSCLFMMQALCKGGYMEEVNAYCFTLCKNF 359 F MET R+M EK IGLNN+ L MMQALCKGGY+EE + + L + + Sbjct: 110 FVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERY 157 >gb|ESR34480.1| hypothetical protein CICLE_v10004328mg [Citrus clementina] Length = 782 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 502 FAMETVRIMREKGIGLNNRSCLFMMQALCKGGYMEEVNAYCFTLCKNF 359 F MET R+M EK IGLNN+ L MMQALCKGGY+EE + + L + + Sbjct: 69 FVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERY 116 >gb|ESR34479.1| hypothetical protein CICLE_v10004328mg [Citrus clementina] Length = 548 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 502 FAMETVRIMREKGIGLNNRSCLFMMQALCKGGYMEEVNAYCFTLCKNF 359 F MET R+M EK IGLNN+ L MMQALCKGGY+EE + + L + + Sbjct: 110 FVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERY 157