BLASTX nr result
ID: Jatropha_contig00014349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014349 (173 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE93324.2| hypothetical protein POPTR_0005s08220g [Populus t... 76 4e-12 ref|XP_002528990.1| conserved hypothetical protein [Ricinus comm... 71 2e-11 gb|EOX92209.1| RNase L inhibitor protein-related isoform 1 [Theo... 72 9e-11 gb|ESR41365.1| hypothetical protein CICLE_v10027591mg [Citrus cl... 69 5e-10 ref|XP_002873436.1| hypothetical protein ARALYDRAFT_487833 [Arab... 65 9e-09 ref|XP_006288455.1| hypothetical protein CARUB_v10001716mg [Caps... 65 1e-08 gb|ACK44518.1| AT5G10070-like protein [Arabidopsis arenosa] 64 1e-08 gb|ESQ40950.1| hypothetical protein EUTSA_v10014396mg [Eutrema s... 58 1e-06 emb|CBI21472.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EMJ06933.1| hypothetical protein PRUPE_ppa010103mg [Prunus pe... 55 7e-06 ref|NP_974761.1| RNase L inhibitor protein-like protein [Arabido... 55 9e-06 ref|NP_196569.1| RNase L inhibitor protein-like protein [Arabido... 55 9e-06 >gb|EEE93324.2| hypothetical protein POPTR_0005s08220g [Populus trichocarpa] Length = 248 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 43 HNSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 HNSHRGQSSRTN LDR+DESLP DQVPE + P+IQLAMWDF Sbjct: 13 HNSHRGQSSRTNHLDREDESLPHDQVPEEDTTGPKIQLAMWDF 55 >ref|XP_002528990.1| conserved hypothetical protein [Ricinus communis] gi|223531580|gb|EEF33409.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 70.9 bits (172), Expect(2) = 2e-11 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +1 Query: 43 HNSHRGQSSRTNQLDRDDESLPSDQVPEANAN-VPRIQLAMWDF 171 H+S+RGQSSRTN L+R+DESLPSDQVPE + N PR+QLAMWDF Sbjct: 12 HHSNRGQSSRTNLLEREDESLPSDQVPEEDTNSTPRVQLAMWDF 55 Score = 23.1 bits (48), Expect(2) = 2e-11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 11 MGHNKTRRSK 40 MGHNK RRSK Sbjct: 1 MGHNKPRRSK 10 >gb|EOX92209.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao] gi|508700314|gb|EOX92210.1| RNase L inhibitor protein-related isoform 1 [Theobroma cacao] Length = 261 Score = 71.6 bits (174), Expect = 9e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +1 Query: 43 HNSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 H+SHRGQSSRT+Q R+D+SLP DQ PE + NVP+IQLAMWDF Sbjct: 12 HHSHRGQSSRTHQFQREDDSLPPDQPPEEDPNVPKIQLAMWDF 54 >gb|ESR41365.1| hypothetical protein CICLE_v10027591mg [Citrus clementina] Length = 279 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 43 HNSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 H+SHRGQSSR +Q DR+DESLP DQ PE + VP++QLAMWDF Sbjct: 12 HHSHRGQSSRCHQPDREDESLPPDQAPEDDPQVPKVQLAMWDF 54 >ref|XP_002873436.1| hypothetical protein ARALYDRAFT_487833 [Arabidopsis lyrata subsp. lyrata] gi|297319273|gb|EFH49695.1| hypothetical protein ARALYDRAFT_487833 [Arabidopsis lyrata subsp. lyrata] Length = 270 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 46 NSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 NS+RGQ+SRT+ L R+DESLP DQ PE A VP++QLAMWDF Sbjct: 13 NSNRGQTSRTDNLGREDESLPLDQEPEGEAPVPKVQLAMWDF 54 >ref|XP_006288455.1| hypothetical protein CARUB_v10001716mg [Capsella rubella] gi|482557161|gb|EOA21353.1| hypothetical protein CARUB_v10001716mg [Capsella rubella] Length = 269 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 46 NSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 NS+RGQ+SRT+ L R+DESLP DQ PE A VP++QLAMWDF Sbjct: 13 NSNRGQTSRTDNLGREDESLPRDQEPEDEAPVPKVQLAMWDF 54 >gb|ACK44518.1| AT5G10070-like protein [Arabidopsis arenosa] Length = 267 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 46 NSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 NS+RGQ+SRT+ L R+DESLP DQ PE A VP++QLAMWDF Sbjct: 13 NSNRGQTSRTDNLGREDESLPLDQEPEDEAPVPKVQLAMWDF 54 >gb|ESQ40950.1| hypothetical protein EUTSA_v10014396mg [Eutrema salsugineum] Length = 268 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 46 NSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 NS+ GQ+SRT ++R+DESLP DQ PE A P++QLAMWDF Sbjct: 13 NSNPGQTSRTYNIEREDESLPLDQEPEDEAPGPKVQLAMWDF 54 >emb|CBI21472.3| unnamed protein product [Vitis vinifera] Length = 326 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +1 Query: 43 HNSHRGQSSRTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 H SHRGQSSR + R+ +SLP+DQ E +VP++QLAMWDF Sbjct: 12 HQSHRGQSSRFQEPLREYDSLPTDQAEEEELSVPKVQLAMWDF 54 >gb|EMJ06933.1| hypothetical protein PRUPE_ppa010103mg [Prunus persica] Length = 264 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +1 Query: 43 HNSHRGQSSRTNQ-LDRDDESLPSDQVPEANANVPRIQLAMWDF 171 H HRGQSSRTN L + +SLPSDQ E P+IQLAMWDF Sbjct: 10 HKPHRGQSSRTNNHLPHEGDSLPSDQATEEEPTGPKIQLAMWDF 53 >ref|NP_974761.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana] gi|332004106|gb|AED91489.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana] Length = 266 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +1 Query: 43 HNSHRGQSS---RTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 HN +G +S RT+ L R+DESLP DQ PE A VP++QLAMWDF Sbjct: 6 HNRSKGGNSSRGRTDNLAREDESLPLDQEPEDEAPVPKVQLAMWDF 51 >ref|NP_196569.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana] gi|7960726|emb|CAB92048.1| putative protein [Arabidopsis thaliana] gi|27808496|gb|AAO24528.1| At5g10070 [Arabidopsis thaliana] gi|110743648|dbj|BAE99661.1| hypothetical protein [Arabidopsis thaliana] gi|332004107|gb|AED91490.1| RNase L inhibitor protein-like protein [Arabidopsis thaliana] Length = 264 Score = 55.1 bits (131), Expect = 9e-06 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +1 Query: 43 HNSHRGQSS---RTNQLDRDDESLPSDQVPEANANVPRIQLAMWDF 171 HN +G +S RT+ L R+DESLP DQ PE A VP++QLAMWDF Sbjct: 6 HNRSKGGNSSRGRTDNLAREDESLPLDQEPEDEAPVPKVQLAMWDF 51