BLASTX nr result
ID: Jatropha_contig00014307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014307 (130 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR58475.1| hypothetical protein CICLE_v10018463mg [Citrus cl... 78 1e-12 ref|XP_004229821.1| PREDICTED: brefeldin A-inhibited guanine nuc... 77 2e-12 ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communi... 77 2e-12 gb|ESW11984.1| hypothetical protein PHAVU_008G075600g [Phaseolus... 77 3e-12 ref|XP_006339441.1| PREDICTED: brefeldin A-inhibited guanine nuc... 76 4e-12 gb|ESW06891.1| hypothetical protein PHAVU_010G085000g [Phaseolus... 76 4e-12 ref|XP_006282259.1| hypothetical protein CARUB_v10028536mg [Caps... 76 5e-12 gb|EOX96191.1| SEC7-like guanine nucleotide exchange family prot... 75 6e-12 ref|XP_004492642.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 6e-12 gb|EMJ21776.1| hypothetical protein PRUPE_ppa000110mg [Prunus pe... 75 6e-12 ref|XP_003623725.1| Brefeldin A-inhibited guanine nucleotide-exc... 75 6e-12 ref|XP_003552344.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 ref|XP_003521643.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 ref|XP_003517058.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 ref|XP_002876586.1| guanine nucleotide exchange family protein [... 75 1e-11 emb|CBI38863.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002279696.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 ref|XP_003534607.1| PREDICTED: brefeldin A-inhibited guanine nuc... 74 1e-11 gb|EPS60966.1| hypothetical protein M569_13835 [Genlisea aurea] 74 2e-11 ref|NP_171698.1| brefeldin A-inhibited guanine nucleotide-exchan... 74 2e-11 >gb|ESR58475.1| hypothetical protein CICLE_v10018463mg [Citrus clementina] Length = 1779 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 N+PEEIAAFLKNAS LNKTLIGDYLGEREELPLKVMHA VD Sbjct: 642 NTPEEIAAFLKNASDLNKTLIGDYLGEREELPLKVMHAYVD 682 >ref|XP_004229821.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Solanum lycopersicum] Length = 1778 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLK+ASGLNKTLIGDYLGER++LPLKVMHA VD Sbjct: 642 NSPEEIAAFLKDASGLNKTLIGDYLGERDDLPLKVMHAYVD 682 >ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communis] gi|223548912|gb|EEF50401.1| cytohesin 1, 2, 3, putative [Ricinus communis] Length = 1780 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLKNASGLNKTLIGDYLGERE+L LKVMHA VD Sbjct: 641 NSPEEIAAFLKNASGLNKTLIGDYLGEREDLSLKVMHAYVD 681 >gb|ESW11984.1| hypothetical protein PHAVU_008G075600g [Phaseolus vulgaris] Length = 1783 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLK+ASGLNKTLIGDYLGEREEL LKVMHA VD Sbjct: 645 NSPEEIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVD 685 >ref|XP_006339441.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Solanum tuberosum] Length = 1778 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPE+IAAFLK+ASGLNKTLIGDYLGER++LPLKVMHA VD Sbjct: 642 NSPEQIAAFLKDASGLNKTLIGDYLGERDDLPLKVMHAYVD 682 >gb|ESW06891.1| hypothetical protein PHAVU_010G085000g [Phaseolus vulgaris] Length = 1786 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPE+IAAFLK ASGLNKTLIGDYLGEREELPLKVMHA VD Sbjct: 651 DSPEDIAAFLKEASGLNKTLIGDYLGEREELPLKVMHAYVD 691 >ref|XP_006282259.1| hypothetical protein CARUB_v10028536mg [Capsella rubella] gi|482550963|gb|EOA15157.1| hypothetical protein CARUB_v10028536mg [Capsella rubella] Length = 1785 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 5 SPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 SPEEIAAFL++ASGLNKTLIGDYLGEREELPLKVMHA VD Sbjct: 644 SPEEIAAFLQDASGLNKTLIGDYLGEREELPLKVMHAYVD 683 >gb|EOX96191.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] Length = 1778 Score = 75.5 bits (184), Expect = 6e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLKNASGLNKTLIGDYLGERE+L LKVMHA VD Sbjct: 640 DSPEEIAAFLKNASGLNKTLIGDYLGEREDLSLKVMHAYVD 680 >ref|XP_004492642.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cicer arietinum] Length = 1788 Score = 75.5 bits (184), Expect = 6e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLK+ASGLNKTLIGDYLGERE+L LKVMHA VD Sbjct: 650 NSPEEIAAFLKDASGLNKTLIGDYLGEREDLSLKVMHAYVD 690 >gb|EMJ21776.1| hypothetical protein PRUPE_ppa000110mg [Prunus persica] Length = 1775 Score = 75.5 bits (184), Expect = 6e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLKNASGLNKTLIGDYLGERE+L LKVMHA VD Sbjct: 640 DSPEEIAAFLKNASGLNKTLIGDYLGEREDLSLKVMHAYVD 680 >ref|XP_003623725.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] gi|355498740|gb|AES79943.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] Length = 1789 Score = 75.5 bits (184), Expect = 6e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPE+IAAFLK+ASGLNKTLIGDYLGEREEL LKVMHA VD Sbjct: 647 NSPEDIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVD 687 >ref|XP_003552344.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Glycine max] Length = 1783 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLK+ASGLNKTLIGDYLGEREEL LKVMHA VD Sbjct: 647 DSPEEIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVD 687 >ref|XP_003521643.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Glycine max] Length = 1782 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLK+ASGLNKTLIGDYLGEREEL LKVMHA VD Sbjct: 648 DSPEEIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVD 688 >ref|XP_003517058.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Glycine max] Length = 1783 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLK+ASGLNKTLIGDYLGEREEL LKVMHA VD Sbjct: 648 DSPEEIAAFLKDASGLNKTLIGDYLGEREELSLKVMHAYVD 688 >ref|XP_002876586.1| guanine nucleotide exchange family protein [Arabidopsis lyrata subsp. lyrata] gi|297322424|gb|EFH52845.1| guanine nucleotide exchange family protein [Arabidopsis lyrata subsp. lyrata] Length = 1793 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 5 SPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 SPEEIA FLK+ASGLNKTLIGDYLGERE+LPLKVMHA VD Sbjct: 649 SPEEIAGFLKDASGLNKTLIGDYLGEREDLPLKVMHAYVD 688 >emb|CBI38863.3| unnamed protein product [Vitis vinifera] Length = 1753 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 N+PEEIAAFLKNAS LNKTLIGDYLGEREEL LKVMHA VD Sbjct: 614 NTPEEIAAFLKNASDLNKTLIGDYLGEREELSLKVMHAYVD 654 >ref|XP_002279696.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Vitis vinifera] Length = 1779 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 N+PEEIAAFLKNAS LNKTLIGDYLGEREEL LKVMHA VD Sbjct: 640 NTPEEIAAFLKNASDLNKTLIGDYLGEREELSLKVMHAYVD 680 >ref|XP_003534607.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Glycine max] Length = 1784 Score = 74.3 bits (181), Expect = 1e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLK+ASGLNKTLIGDYLGEREE LKVMHA VD Sbjct: 646 NSPEEIAAFLKDASGLNKTLIGDYLGEREESSLKVMHAYVD 686 >gb|EPS60966.1| hypothetical protein M569_13835 [Genlisea aurea] Length = 1776 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 NSPEEIAAFLKN +GLNKTLIGDYLGERE+L L+VMHA VD Sbjct: 645 NSPEEIAAFLKNGTGLNKTLIGDYLGEREDLSLRVMHAYVD 685 >ref|NP_171698.1| brefeldin A-inhibited guanine nucleotide-exchange protein 3 [Arabidopsis thaliana] gi|75264111|sp|Q9LPC5.1|BIG3_ARATH RecName: Full=Brefeldin A-inhibited guanine nucleotide-exchange protein 3; Short=BIG3; AltName: Full=ARF guanine-nucleotide exchange factor BIG3; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 10 gi|8570447|gb|AAF76474.1|AC020622_8 Contains similarity to a guanine nucleotide exchange factor from Homo sapiens gb|AF111162 and contains a Sec7 PF|01369 domain [Arabidopsis thaliana] gi|332189239|gb|AEE27360.1| brefeldin A-inhibited guanine nucleotide-exchange protein 3 [Arabidopsis thaliana] Length = 1750 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 NSPEEIAAFLKNASGLNKTLIGDYLGEREELPLKVMHANVD 124 +SPEEIAAFLK+ASGLNKTLIGDYLGERE+L LKVMHA VD Sbjct: 638 DSPEEIAAFLKDASGLNKTLIGDYLGEREDLSLKVMHAYVD 678