BLASTX nr result
ID: Jatropha_contig00014154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014154 (259 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago ... 64 3e-08 ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia olerac... 62 1e-07 gb|AFK48586.1| unknown [Medicago truncatula] 59 8e-07 >ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago truncatula] gi|355518112|gb|AES99735.1| hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 200 FRENKGVISFHGGSVNYWAELDLNQRRHIANEFT 99 F+ K VIS HGGSVN+WAELDLNQRRHIANEFT Sbjct: 5 FKNTKWVISLHGGSVNFWAELDLNQRRHIANEFT 38 >ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia oleracea] gi|7636100|emb|CAB88720.1| hypothetical protein [Spinacia oleracea] Length = 83 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +3 Query: 72 MPERLMGTDCKFVGNMSTLVQIQLGPIIH*SAMK*YNPLVLSKYLI 209 MPERLMGTDCKFVGNMSTLVQIQLGPII S ++ VL K LI Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPIISSSIIE-MKVFVLPKRLI 45 >gb|AFK48586.1| unknown [Medicago truncatula] Length = 29 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 72 MPERLMGTDCKFVGNMSTLVQIQLGPIIH 158 MPERLMGTDCKFVGNMSTLVQIQLGP I+ Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPKIY 29