BLASTX nr result
ID: Jatropha_contig00014030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00014030 (613 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530313.1| pentatricopeptide repeat-containing protein,... 112 1e-22 ref|XP_004230378.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 gb|ERN03219.1| hypothetical protein AMTR_s00003p00166290 [Ambore... 62 1e-07 ref|XP_006358504.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 gb|EOY17477.1| Tetratricopeptide repeat-like superfamily protein... 60 5e-07 gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus pe... 58 2e-06 >ref|XP_002530313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530169|gb|EEF32080.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 328 Score = 112 bits (279), Expect = 1e-22 Identities = 66/148 (44%), Positives = 66/148 (44%) Frame = +1 Query: 169 MQMEVLAMSQAXXXXXXXXXXXXXXXXXXXXXXXXXXPGPLCXXXXXXXXXXXXXXXXXX 348 MQMEVLAMSQA PGPLC Sbjct: 1 MQMEVLAMSQATRLRLFLKRSLLSKLSFTSTATSKATPGPLCPPWLLRLVRSSPSRLPPQ 60 Query: 349 XXXXXNALAYLQHQNQLRSFCXXXXXXXXXXXXXXXXXVNFXXXXXXXXXXXXXXXXKNK 528 NALAYLQHQNQLRSFC VNF KNK Sbjct: 61 QPPVLNALAYLQHQNQLRSFCSKPTSEKETTKTITNTKVNFSLSDSDSDSDLDSEDSKNK 120 Query: 529 EIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 EIDKTKLPPPYDPFNKKPVIEEPDDPNN Sbjct: 121 EIDKTKLPPPYDPFNKKPVIEEPDDPNN 148 >ref|XP_004230378.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum lycopersicum] Length = 323 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 526 KEIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 KEIDK+KLPPPYDPFNKKPVIEEP+DP N Sbjct: 112 KEIDKSKLPPPYDPFNKKPVIEEPEDPTN 140 >gb|ERN03219.1| hypothetical protein AMTR_s00003p00166290 [Amborella trichopoda] Length = 323 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 520 KNKEIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 KNK IDK+KLPPPYDPF+KKPV+EEP+DP N Sbjct: 115 KNKVIDKSKLPPPYDPFSKKPVVEEPEDPKN 145 >ref|XP_006358504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum tuberosum] Length = 322 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 526 KEIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 K+IDK+KLPPPYDPFNKKPVIEEP+DP N Sbjct: 111 KQIDKSKLPPPYDPFNKKPVIEEPEDPTN 139 >gb|EOY17477.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 314 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 520 KNKEIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 + +E+DK+KLPPPYDPFNKKP+IEEP DP N Sbjct: 103 RKQELDKSKLPPPYDPFNKKPIIEEPQDPKN 133 >gb|EMJ06797.1| hypothetical protein PRUPE_ppa008917mg [Prunus persica] Length = 314 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 526 KEIDKTKLPPPYDPFNKKPVIEEPDDPNN 612 KEIDK+KLPPPYDPFNKKP IE+P+DP + Sbjct: 114 KEIDKSKLPPPYDPFNKKPAIEDPEDPKD 142