BLASTX nr result
ID: Jatropha_contig00013940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013940 (129 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79785.1| hypothetical protein VITISV_002634 [Vitis vinifera] 55 9e-06 >emb|CAN79785.1| hypothetical protein VITISV_002634 [Vitis vinifera] Length = 245 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 3 GRIYLSKDSALINDIIEQFHNSTHEGFFKTLQRIR 107 GRIYL+KDS L II QFH STHEG+ KTLQRI+ Sbjct: 51 GRIYLTKDSKLTTKIISQFHGSTHEGYMKTLQRIK 85