BLASTX nr result
ID: Jatropha_contig00013862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013862 (247 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517736.1| conserved hypothetical protein [Ricinus comm... 116 1e-28 >ref|XP_002517736.1| conserved hypothetical protein [Ricinus communis] gi|223543134|gb|EEF44668.1| conserved hypothetical protein [Ricinus communis] Length = 887 Score = 116 bits (291), Expect(2) = 1e-28 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = +3 Query: 42 MSLDQNSPPLPSSSRDWFFPSPSLINQPHHHIPPSTSKHYRRFSRISHSTNHRGFQP 212 MSLDQ+SPPLPSSSRDWFFPSPSLINQPHHHIPPSTSKHYRRFSRISHST+HR P Sbjct: 1 MSLDQDSPPLPSSSRDWFFPSPSLINQPHHHIPPSTSKHYRRFSRISHSTSHRDSNP 57 Score = 35.4 bits (80), Expect(2) = 1e-28 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 202 DSNPLKTPSFPSPIS 246 DSNPLKTPSFPSPIS Sbjct: 54 DSNPLKTPSFPSPIS 68