BLASTX nr result
ID: Jatropha_contig00013801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013801 (186 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519263.1| FK506-binding protein, putative [Ricinus com... 67 3e-09 >ref|XP_002519263.1| FK506-binding protein, putative [Ricinus communis] gi|223541578|gb|EEF43127.1| FK506-binding protein, putative [Ricinus communis] Length = 321 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 80 KFFEKENKIRVFGEPEEENSTDADSETKQSVEVEE 184 + EKENKIRVFGEPEEENSTDADSETKQSVEVEE Sbjct: 9 EILEKENKIRVFGEPEEENSTDADSETKQSVEVEE 43