BLASTX nr result
ID: Jatropha_contig00013728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013728 (250 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative... 55 9e-06 >ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis] gi|223529809|gb|EEF31744.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis] Length = 287 Score = 55.1 bits (131), Expect = 9e-06 Identities = 32/48 (66%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 101 MAKARYSRLPVRKXXXXXXXXXXXX-MFTFVILNLLALGILSIPSNSG 241 MAKARYSRLP RK MFTFVIL LLALGILS+PSNSG Sbjct: 1 MAKARYSRLPARKSSSPTTMILTMLLMFTFVILILLALGILSVPSNSG 48