BLASTX nr result
ID: Jatropha_contig00013691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013691 (252 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 142 4e-32 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 142 bits (358), Expect = 4e-32 Identities = 67/74 (90%), Positives = 72/74 (97%) Frame = -3 Query: 232 FGFGAMMEEMCPLFEEFCAIIGCDPNAPLVRHGVKVGYVRSFENLFQFSRPQAKAMIVDD 53 F FGAMMEEMCPLFEEFCAIIGCDPNAPLVRH VKVGYV+SFE+LFQFSRPQA+AMIVDD Sbjct: 59 FRFGAMMEEMCPLFEEFCAIIGCDPNAPLVRHEVKVGYVQSFESLFQFSRPQARAMIVDD 118 Query: 52 QKAILMPLIDEFSD 11 QKAIL+PLIDEFS+ Sbjct: 119 QKAILLPLIDEFSE 132