BLASTX nr result
ID: Jatropha_contig00013624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013624 (298 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago ... 79 8e-13 ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia olerac... 62 1e-07 gb|AFK48586.1| unknown [Medicago truncatula] 59 8e-07 ref|XP_003605618.1| Photosystem II reaction center protein M [Me... 46 6e-06 >ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago truncatula] gi|355518112|gb|AES99735.1| hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 78.6 bits (192), Expect = 8e-13 Identities = 43/79 (54%), Positives = 45/79 (56%) Frame = -3 Query: 239 FRENKGVISFHGGSVNYWAELDLNQRRHIANEFTVRPH*PLGHRPRKNQFQTY**SMINF 60 F+ K VIS HGGSVN+WAELDLNQRRHIANEFT Sbjct: 5 FKNTKWVISLHGGSVNFWAELDLNQRRHIANEFT-------------------------- 38 Query: 59 LS*YPTPRGSRIPAASLKE 3 YPTPRGSRIP ASLKE Sbjct: 39 ---YPTPRGSRIPVASLKE 54 >ref|NP_054927.1| hypothetical protein SpolCp017 [Spinacia oleracea] gi|7636100|emb|CAB88720.1| hypothetical protein [Spinacia oleracea] Length = 83 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +3 Query: 111 MPERLMGTDCKFVGNMSTLVQIQLGPIIH*SAMK*YNPLVLSKYLI 248 MPERLMGTDCKFVGNMSTLVQIQLGPII S ++ VL K LI Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPIISSSIIE-MKVFVLPKRLI 45 >gb|AFK48586.1| unknown [Medicago truncatula] Length = 29 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 111 MPERLMGTDCKFVGNMSTLVQIQLGPIIH 197 MPERLMGTDCKFVGNMSTLVQIQLGP I+ Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPKIY 29 >ref|XP_003605618.1| Photosystem II reaction center protein M [Medicago truncatula] gi|355506673|gb|AES87815.1| Photosystem II reaction center protein M [Medicago truncatula] Length = 164 Score = 46.2 bits (108), Expect(2) = 6e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +3 Query: 120 RLMGTDCKFVGNMSTLVQIQLGPII 194 RLMGTDCKFVGNMSTLVQIQL ++ Sbjct: 71 RLMGTDCKFVGNMSTLVQIQLVQLV 95 Score = 29.3 bits (64), Expect(2) = 6e-06 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 1 LSFKEAAGIRLPLG 42 LSFKEA GIRLPLG Sbjct: 57 LSFKEATGIRLPLG 70