BLASTX nr result
ID: Jatropha_contig00013608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013608 (745 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 118 2e-45 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 118 bits (295), Expect(3) = 2e-45 Identities = 57/66 (86%), Positives = 59/66 (89%) Frame = -2 Query: 723 FCICLISVFCLIKDPGFEDLRFCPMIRQMEDMSCIGGIVLAETIRSLDRAALGFEDWTVS 544 F CL+S F KDPGF DLRFCPMIRQMEDMSCIGGIVL+ETIRSLDRAALGFEDWTVS Sbjct: 148 FVFCLLSGFLFNKDPGFGDLRFCPMIRQMEDMSCIGGIVLSETIRSLDRAALGFEDWTVS 207 Query: 543 PIILQV 526 PIILQV Sbjct: 208 PIILQV 213 Score = 88.6 bits (218), Expect(3) = 2e-45 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 469 ERIHYSGLVEGSPSSGRCSYPFALQPFSVSYAEDLDHTPVC 347 ERIHYSGLVEGSP SGRCSYPFALQPFSVSYAEDLDHTPVC Sbjct: 234 ERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTPVC 274 Score = 23.5 bits (49), Expect(3) = 2e-45 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 743 MRLRMRAFVF 714 MRLRMRAFVF Sbjct: 141 MRLRMRAFVF 150