BLASTX nr result
ID: Jatropha_contig00013403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013403 (258 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525408.1| conserved hypothetical protein [Ricinus comm... 99 6e-19 >ref|XP_002525408.1| conserved hypothetical protein [Ricinus communis] gi|223535299|gb|EEF36975.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = +3 Query: 3 EITIVQRSAGLKVFPVAGVADFVANRIVPGAVKTLLPIRRRCRLLKDIEYDIC 161 EITIVQRSAGLKVFPVAGVADFVAN VPGAVKTLLPIR+RCRLL+D+EYDIC Sbjct: 50 EITIVQRSAGLKVFPVAGVADFVANAFVPGAVKTLLPIRQRCRLLQDMEYDIC 102