BLASTX nr result
ID: Jatropha_contig00013374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013374 (675 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 61 3e-07 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 5/61 (8%) Frame = -2 Query: 674 LHIFSSPLFY-----HSL*IERIHYSGLVEGPPSSGYCSYFPSL*PFSVSHAEDFNLTSH 510 L + S P F+ HS IERIHYSGLVEG P SG CSY +L PFSVS+AED + T Sbjct: 214 LLLSSFPYFFFCVLIHSFVIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTPV 273 Query: 509 C 507 C Sbjct: 274 C 274