BLASTX nr result
ID: Jatropha_contig00013311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013311 (105 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] 72 6e-11 >dbj|BAJ53209.1| JHL23C09.1 [Jatropha curcas] Length = 525 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 GLHLRCVDEEEAQTIMDSLHNGEFGPHMHGVALA 104 GLHLRCVDEEEAQTIMDSLHNGE GPHMHG+ALA Sbjct: 158 GLHLRCVDEEEAQTIMDSLHNGESGPHMHGIALA 191