BLASTX nr result
ID: Jatropha_contig00013247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013247 (453 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus t... 70 4e-10 gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/see... 64 2e-08 ref|XP_002533296.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220... 62 6e-08 >gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] Length = 234 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 54 MGSKLEALLFNFMIFMAISLPPIYACAPCTQPHPPGH 164 MGSK A+LF FMIFMAISLPPIYAC PCTQPHPP + Sbjct: 1 MGSKFAAMLFIFMIFMAISLPPIYACTPCTQPHPPSY 37 >gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 239 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 54 MGSKLEALLFNFMIFMAISLPPIYACAPCTQPHPP 158 MGS+ AL+F F+IFM ISLPPIYAC PCTQPHPP Sbjct: 1 MGSQFTALIFIFLIFMLISLPPIYACVPCTQPHPP 35 >ref|XP_002533296.1| conserved hypothetical protein [Ricinus communis] gi|223526880|gb|EEF29090.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 63 KLEALLFNFMIFMAISLPPIYACAPCTQPHPPGH 164 K+ A+ F FMIFMAISLPPIYAC PCTQPHPP H Sbjct: 5 KVAAMSFIFMIFMAISLPPIYACTPCTQPHPPSH 38 >ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220939 [Cucumis sativus] Length = 253 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 51 IMGSKLEALLFNFMIFMAISLPPIYACAPCTQPHPP 158 +MGSK A+ F IFMA+SLPPIYAC PCTQPHPP Sbjct: 1 MMGSKASAMFFILSIFMALSLPPIYACTPCTQPHPP 36