BLASTX nr result
ID: Jatropha_contig00013161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013161 (292 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166093.1| PREDICTED: LOW QUALITY PROTEIN: squamosa pro... 69 6e-10 ref|XP_004148578.1| PREDICTED: squamosa promoter-binding-like pr... 69 6e-10 gb|EEE98579.2| hypothetical protein POPTR_0014s10960g [Populus t... 67 2e-09 gb|EOY06897.1| Squamosa promoter-binding protein, putative isofo... 67 2e-09 gb|EOY06896.1| Squamosa promoter-binding protein, putative isofo... 67 2e-09 gb|EOX95415.1| Squamosa promoter-binding protein, putative isofo... 67 2e-09 gb|EOX95414.1| Squamosa promoter-binding protein, putative isofo... 67 2e-09 emb|CBI26003.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002274934.1| PREDICTED: squamosa promoter-binding-like pr... 67 2e-09 ref|XP_002320264.1| predicted protein [Populus trichocarpa] 67 2e-09 emb|CAN74605.1| hypothetical protein VITISV_025316 [Vitis vinifera] 67 2e-09 gb|ESR32495.1| hypothetical protein CICLE_v10004227mg [Citrus cl... 67 3e-09 gb|ESR32493.1| hypothetical protein CICLE_v10004227mg [Citrus cl... 67 3e-09 gb|ESR32491.1| hypothetical protein CICLE_v10004227mg [Citrus cl... 67 3e-09 ref|XP_003632418.1| PREDICTED: squamosa promoter-binding-like pr... 67 3e-09 emb|CBI37021.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002273228.1| PREDICTED: squamosa promoter-binding-like pr... 67 3e-09 ref|XP_002515202.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 emb|CAN70646.1| hypothetical protein VITISV_006196 [Vitis vinifera] 67 3e-09 gb|ESR57835.1| hypothetical protein CICLE_v10018697mg [Citrus cl... 66 4e-09 >ref|XP_004166093.1| PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 12-like [Cucumis sativus] Length = 1014 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YGTS Sbjct: 982 AVCVCVALLFKSSPEVLYVFRPFRWELLDYGTS 1014 >ref|XP_004148578.1| PREDICTED: squamosa promoter-binding-like protein 12-like [Cucumis sativus] Length = 1013 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YGTS Sbjct: 981 AVCVCVALLFKSSPEVLYVFRPFRWELLDYGTS 1013 >gb|EEE98579.2| hypothetical protein POPTR_0014s10960g [Populus trichocarpa] Length = 1004 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEV+YVFRPFRWELL YGTS Sbjct: 972 AVCVCVALLFKSCPEVLYVFRPFRWELLDYGTS 1004 >gb|EOY06897.1| Squamosa promoter-binding protein, putative isoform 2 [Theobroma cacao] Length = 899 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YG+S Sbjct: 867 AVCVCVALLFKSSPEVLYVFRPFRWELLKYGSS 899 >gb|EOY06896.1| Squamosa promoter-binding protein, putative isoform 1 [Theobroma cacao] Length = 1032 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YG+S Sbjct: 1000 AVCVCVALLFKSSPEVLYVFRPFRWELLKYGSS 1032 >gb|EOX95415.1| Squamosa promoter-binding protein, putative isoform 2 [Theobroma cacao] Length = 982 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEV+YVFRPFRWELL YGTS Sbjct: 950 AVCVCVALLFKSCPEVLYVFRPFRWELLDYGTS 982 >gb|EOX95414.1| Squamosa promoter-binding protein, putative isoform 1 [Theobroma cacao] Length = 981 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEV+YVFRPFRWELL YGTS Sbjct: 949 AVCVCVALLFKSCPEVLYVFRPFRWELLDYGTS 981 >emb|CBI26003.3| unnamed protein product [Vitis vinifera] Length = 980 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YG+S Sbjct: 948 AVCVCVALLFKSSPEVLYVFRPFRWELLKYGSS 980 >ref|XP_002274934.1| PREDICTED: squamosa promoter-binding-like protein 1-like [Vitis vinifera] Length = 1029 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YG+S Sbjct: 997 AVCVCVALLFKSSPEVLYVFRPFRWELLKYGSS 1029 >ref|XP_002320264.1| predicted protein [Populus trichocarpa] Length = 749 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEV+YVFRPFRWELL YGTS Sbjct: 717 AVCVCVALLFKSCPEVLYVFRPFRWELLDYGTS 749 >emb|CAN74605.1| hypothetical protein VITISV_025316 [Vitis vinifera] Length = 967 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVFRPFRWELL YG+S Sbjct: 935 AVCVCVALLFKSSPEVLYVFRPFRWELLKYGSS 967 >gb|ESR32495.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 1038 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+Y+FRPFRWELL YG+S Sbjct: 1006 AVCVCVALLFKSSPEVLYIFRPFRWELLKYGSS 1038 >gb|ESR32493.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 845 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+Y+FRPFRWELL YG+S Sbjct: 813 AVCVCVALLFKSSPEVLYIFRPFRWELLKYGSS 845 >gb|ESR32491.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] gi|557521125|gb|ESR32492.1| hypothetical protein CICLE_v10004227mg [Citrus clementina] Length = 709 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+Y+FRPFRWELL YG+S Sbjct: 677 AVCVCVALLFKSSPEVLYIFRPFRWELLKYGSS 709 >ref|XP_003632418.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform 2 [Vitis vinifera] Length = 963 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVF PFRWELL YGTS Sbjct: 931 AVCVCVALLFKSSPEVLYVFTPFRWELLDYGTS 963 >emb|CBI37021.3| unnamed protein product [Vitis vinifera] Length = 860 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVF PFRWELL YGTS Sbjct: 828 AVCVCVALLFKSSPEVLYVFTPFRWELLDYGTS 860 >ref|XP_002273228.1| PREDICTED: squamosa promoter-binding-like protein 12-like isoform 1 [Vitis vinifera] Length = 997 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVF PFRWELL YGTS Sbjct: 965 AVCVCVALLFKSSPEVLYVFTPFRWELLDYGTS 997 >ref|XP_002515202.1| conserved hypothetical protein [Ricinus communis] gi|223545682|gb|EEF47186.1| conserved hypothetical protein [Ricinus communis] Length = 1012 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEVVYVFRPFRWELL +GTS Sbjct: 980 AVCVCVALLFKSCPEVVYVFRPFRWELLDFGTS 1012 >emb|CAN70646.1| hypothetical protein VITISV_006196 [Vitis vinifera] Length = 943 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKSSPEV+YVF PFRWELL YGTS Sbjct: 911 AVCVCVALLFKSSPEVLYVFTPFRWELLDYGTS 943 >gb|ESR57835.1| hypothetical protein CICLE_v10018697mg [Citrus clementina] Length = 988 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 AVCVCVALLFKSSPEVVYVFRPFRWELLGYGTS 101 AVCVCVALLFKS PEV+YVFRPFRWE+L YGTS Sbjct: 956 AVCVCVALLFKSCPEVLYVFRPFRWEMLDYGTS 988