BLASTX nr result
ID: Jatropha_contig00013121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013121 (207 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517889.1| conserved hypothetical protein [Ricinus comm... 69 8e-10 >ref|XP_002517889.1| conserved hypothetical protein [Ricinus communis] gi|223542871|gb|EEF44407.1| conserved hypothetical protein [Ricinus communis] Length = 346 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = -1 Query: 207 SDSKPLSETKESIPSEKSLLFPEVKEKVKTVSSTRNETPERTPKQGFDSSKAFTGSIVER 28 S+ K L+ +K SI +EK+L P KE+++TVSS+RNE P + K FDSS AFTGSIVER Sbjct: 213 SNIKSLTHSKNSILAEKALQLPSAKEEIETVSSSRNEVPLQNSKSRFDSSNAFTGSIVER 272 Query: 27 TVDL 16 + +L Sbjct: 273 SGNL 276