BLASTX nr result
ID: Jatropha_contig00012938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012938 (504 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514593.1| UDP-glucosyltransferase, putative [Ricinus c... 67 3e-09 ref|XP_002514594.1| UDP-glucosyltransferase, putative [Ricinus c... 59 6e-07 >ref|XP_002514593.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223546197|gb|EEF47699.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 479 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +3 Query: 51 RPGRLKAKKLQEAAMSAIKGGSSDADLDELVKKLNELKIENGG 179 R R++AKKL+EAA SA+KGGSS+ADLD L+K+LNELK+ENGG Sbjct: 418 RRERVRAKKLKEAARSAVKGGSSEADLDRLIKRLNELKLENGG 460 >ref|XP_002514594.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223546198|gb|EEF47700.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 461 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 54 PGRLKAKKLQEAAMSAIKGGSSDADLDELVKKLNELK 164 P R+KAK+LQEAA++A+KGGSSDADLD LV +LNELK Sbjct: 424 PERVKAKELQEAALNAVKGGSSDADLDGLVSRLNELK 460